Germany
Japan
United Kingdom
China
TCF7 (Myc-DDK-tagged)-Human transcription factor 7 (T-cell specific, HMG-box) (TCF7), transcript variant 4
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
TCF7 (Myc-DDK-tagged)-Human transcription factor 7 (T-cell specific, HMG-box) (TCF7), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
TCF7 (GFP-tagged) - Human transcription factor 7 (T-cell specific, HMG-box) (TCF7), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
TCF7 (GFP-tagged) - Human transcription factor 7 (T-cell specific, HMG-box) (TCF7), transcript variant 4
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
TCF7 (Myc-DDK-tagged)-Human transcription factor 7 (T-cell specific, HMG-box) (TCF7), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
TCF7 (Myc-DDK-tagged)-Human transcription factor 7 (T-cell specific, HMG-box) (TCF7), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti-ORF clone of TCF7 (Myc-DDK-tagged)-Human transcription factor 7 (T-cell specific, HMG-box) (TCF7), transcript variant 2
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, TCF7 (Myc-DDK-tagged)-Human transcription factor 7 (T-cell specific, HMG-box) (TCF7), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of TCF7 (mGFP-tagged)-Human transcription factor 7 (T-cell specific, HMG-box) (TCF7), transcript variant 2
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, TCF7 (mGFP-tagged)-Human transcription factor 7 (T-cell specific, HMG-box) (TCF7), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
TCF7 (Myc-DDK-tagged)-Human transcription factor 7 (T-cell specific, HMG-box) (TCF7), transcript variant 5
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti-ORF clone of TCF7 (Myc-DDK-tagged)-Human transcription factor 7 (T-cell specific, HMG-box) (TCF7), transcript variant 5
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, TCF7 (Myc-DDK-tagged)-Human transcription factor 7 (T-cell specific, HMG-box) (TCF7), transcript variant 5, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of TCF7 (mGFP-tagged)-Human transcription factor 7 (T-cell specific, HMG-box) (TCF7), transcript variant 5
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, TCF7 (mGFP-tagged)-Human transcription factor 7 (T-cell specific, HMG-box) (TCF7), transcript variant 5, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of TCF7 (Myc-DDK-tagged)-Human transcription factor 7 (T-cell specific, HMG-box) (TCF7), transcript variant 1
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, TCF7 (Myc-DDK-tagged)-Human transcription factor 7 (T-cell specific, HMG-box) (TCF7), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF particles, TCF7 (mGFP-tagged)-Human transcription factor 7 (T-cell specific, HMG-box) (TCF7), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human transcription factor 7 (T-cell specific, HMG-box) (TCF7), transcript variant 4, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, TCF7 (Myc-DDK tagged) - Human transcription factor 7 (T-cell specific, HMG-box) (TCF7), transcript variant 4, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF particles, TCF7 (mGFP-tagged) - Human transcription factor 7 (T-cell specific, HMG-box) (TCF7), transcript variant 4, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of TCF7 (Myc-DDK-tagged)-Human transcription factor 7 (T-cell specific, HMG-box) (TCF7), transcript variant 3
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti-ORF clone of TCF7 (mGFP-tagged)-Human transcription factor 7 (T-cell specific, HMG-box) (TCF7), transcript variant 3
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, TCF7 (mGFP-tagged)-Human transcription factor 7 (T-cell specific, HMG-box) (TCF7), transcript variant 3, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
TCF7 (GFP-tagged) - Human transcription factor 7 (T-cell specific, HMG-box) (TCF7), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
TCF7 (GFP-tagged) - Human transcription factor 7 (T-cell specific, HMG-box) (TCF7), transcript variant 5
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
TCF7 (GFP-tagged) - Human transcription factor 7 (T-cell specific, HMG-box) (TCF7), transcript variant 3
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti-ORF clone of TCF7 (mGFP-tagged)-Human transcription factor 7 (T-cell specific, HMG-box) (TCF7), transcript variant 1
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
TCF7 (untagged)-Human transcription factor 7 (T-cell specific, HMG-box) (TCF7), transcript variant 1
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti-ORF clone of TCF7 (mGFP-tagged)-Human transcription factor 7 (T-cell specific, HMG-box) (TCF7), transcript variant 1
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF clone of Human transcription factor 7 (T-cell specific, HMG-box) (TCF7), transcript variant 4, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti-ORF clone of TCF7 (Myc-DDK-tagged)-Human transcription factor 7 (T-cell specific, HMG-box) (TCF7), transcript variant 1
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF particles, TCF7 (Myc-DDK-tagged)-Human transcription factor 7 (T-cell specific, HMG-box) (TCF7), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
-
Lenti ORF particles, TCF7 (Myc-DDK-tagged)-Human transcription factor 7 (T-cell specific, HMG-box) (TCF7), transcript variant 3, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
TCF7 (untagged)-Human transcription factor 7 (T-cell specific, HMG-box) (TCF7), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Lenti ORF particles, TCF7 (mGFP-tagged)-Human transcription factor 7 (T-cell specific, HMG-box) (TCF7), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
-
Rabbit Polyclonal Anti-TCF7 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TCF7 antibody is: synthetic peptide directed towards the N-terminal region of Human TCF7. Synthetic peptide located within the following region: AGGGDDLGAPDELLAFQDEGEEQDDKSRDSAAGPERDLAELKSSLVNESE |
Anti-TCF7 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 255-268 amino acids of human transcription factor 7 (T-cell specific, HMG-box) |
TCF7 (617-631) goat polyclonal antibody, Aff - Purified
| Applications | IHC |
| Reactivities | Bat, Canine, Equine, Hamster, Human, Mouse, Porcine, Rat |
| Immunogen | Synthetic peptide from positions 617-631 of human TCF1 (NP_000536.5) |
TCF7 (untagged)-Human transcription factor 7 (T-cell specific, HMG-box) (TCF7), transcript variant 3
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit polyclonal anti-TCF7 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human TCF7. |
Rabbit Polyclonal Anti-TCF7 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TCF7 antibody: synthetic peptide directed towards the middle region of human TCF7. Synthetic peptide located within the following region: PAAIPHPAIVPPSGKQELQPFDRNLKTQAESKAEKEAKKPTIKKPLNAFM |
Rabbit Polyclonal anti-TCF7 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TCF7 antibody: synthetic peptide directed towards the middle region of human TCF7. Synthetic peptide located within the following region: MQLYPGWSARDNYGKKKRRSREKHQESTTETNWPRELKDGNGQESLSMSS |
Rabbit Polyclonal anti-TCF7 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TCF7 antibody is: synthetic peptide directed towards the C-terminal region of Human TCF7. Synthetic peptide located within the following region: AKYYELARKERQLHMQLYPGWSARDNYGKKKRRSREKHQESTTDNSLHYS |
Rabbit Polyclonal Anti-TCF7 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TCF7 antibody: synthetic peptide directed towards the C terminal of human TCF7. Synthetic peptide located within the following region: YLPGEGRCPSPVPSDDSALGCPGSPAPQDSPSYHLLPRFPTELLTSPAER |
Rabbit Polyclonal Anti-TCF7 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TCF7 antibody: synthetic peptide directed towards the N terminal of human TCF7. Synthetic peptide located within the following region: PQPQPPLHKANQPPHGVPQLSLYEHFNSPHPTPAPADISQKQVHRPLQTP |
TCF7 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of transcription factor 7 (T-cell specific, HMG-box) (TCF7), transcript variant 4
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
TCF7 (untagged)-Human transcription factor 7 (T-cell specific, HMG-box) (TCF7), transcript variant 2
| Vector | pCMV6 series |
| Tag | Tag Free |
TCF7 (untagged)-Human transcription factor 7 (T-cell specific, HMG-box) (TCF7), transcript variant 4
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Active filters
Target Symbol
- TCF7
Pathways
- Arrhythmogenic right ventricular cardiomyopathy (ARVC)