NFAT5 (Myc-DDK-tagged)-Human nuclear factor of activated T-cells 5, tonicity-responsive (NFAT5), transcript variant 6
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
NFAT5 (Myc-DDK-tagged)-Human nuclear factor of activated T-cells 5, tonicity-responsive (NFAT5), transcript variant 6
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
NFAT5 (Myc-DDK-tagged)-Human nuclear factor of activated T-cells 5, tonicity-responsive (NFAT5), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
NFAT5 (Myc-DDK-tagged)-Human nuclear factor of activated T-cells 5, tonicity-responsive (NFAT5), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, NFAT5 (Myc-DDK-tagged)-Human nuclear factor of activated T-cells 5, tonicity-responsive (NFAT5), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, NFAT5 (mGFP-tagged)-Human nuclear factor of activated T-cells 5, tonicity-responsive (NFAT5), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Lenti ORF particles, NFAT5 (Myc-DDK tagged) - Human nuclear factor of activated T-cells 5, tonicity-responsive (NFAT5), transcript variant 6, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, NFAT5 (mGFP-tagged) - Human nuclear factor of activated T-cells 5, tonicity-responsive (NFAT5), transcript variant 6, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
NFAT5 (Myc-DDK-tagged)-Human nuclear factor of activated T-cells 5, tonicity-responsive (NFAT5), transcript variant 4
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, NFAT5 (mGFP-tagged)-Human nuclear factor of activated T-cells 5, tonicity-responsive (NFAT5), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of NFAT5 (Myc-DDK-tagged)-Human nuclear factor of activated T-cells 5, tonicity-responsive (NFAT5), transcript variant 3
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, NFAT5 (Myc-DDK-tagged)-Human nuclear factor of activated T-cells 5, tonicity-responsive (NFAT5), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of NFAT5 (mGFP-tagged)-Human nuclear factor of activated T-cells 5, tonicity-responsive (NFAT5), transcript variant 3
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, NFAT5 (mGFP-tagged)-Human nuclear factor of activated T-cells 5, tonicity-responsive (NFAT5), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of NFAT5 (Myc-DDK-tagged)-Human nuclear factor of activated T-cells 5, tonicity-responsive (NFAT5), transcript variant 4
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, NFAT5 (Myc-DDK-tagged)-Human nuclear factor of activated T-cells 5, tonicity-responsive (NFAT5), transcript variant 4, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of NFAT5 (mGFP-tagged)-Human nuclear factor of activated T-cells 5, tonicity-responsive (NFAT5), transcript variant 4
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, NFAT5 (mGFP-tagged)-Human nuclear factor of activated T-cells 5, tonicity-responsive (NFAT5), transcript variant 4, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of NFAT5 (Myc-DDK-tagged)-Human nuclear factor of activated T-cells 5, tonicity-responsive (NFAT5), transcript variant 1
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, NFAT5 (Myc-DDK-tagged)-Human nuclear factor of activated T-cells 5, tonicity-responsive (NFAT5), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
NFAT5 (Myc-DDK-tagged)-Human nuclear factor of activated T-cells 5, tonicity-responsive (NFAT5), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of NFAT5 (Myc-DDK-tagged)-Human nuclear factor of activated T-cells 5, tonicity-responsive (NFAT5), transcript variant 2
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, NFAT5 (Myc-DDK-tagged)-Human nuclear factor of activated T-cells 5, tonicity-responsive (NFAT5), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of NFAT5 (mGFP-tagged)-Human nuclear factor of activated T-cells 5, tonicity-responsive (NFAT5), transcript variant 2
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, NFAT5 (mGFP-tagged)-Human nuclear factor of activated T-cells 5, tonicity-responsive (NFAT5), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human nuclear factor of activated T-cells 5, tonicity-responsive (NFAT5), transcript variant 6, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, NFAT5 (Myc-DDK tagged) - Human nuclear factor of activated T-cells 5, tonicity-responsive (NFAT5), transcript variant 6, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human nuclear factor of activated T-cells 5, tonicity-responsive (NFAT5), transcript variant 6, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, NFAT5 (mGFP-tagged) - Human nuclear factor of activated T-cells 5, tonicity-responsive (NFAT5), transcript variant 6, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
NFAT5 (Myc-DDK tagged) - Homo sapiens nuclear factor of activated T-cells 5, tonicity-responsive (NFAT5), transcript variant 5
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
NFAT5 (GFP-tagged) - Human nuclear factor of activated T-cells 5, tonicity-responsive (NFAT5), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
NFAT5 (GFP-tagged) - Human nuclear factor of activated T-cells 5, tonicity-responsive (NFAT5), transcript variant 4
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
NFAT5 (GFP-tagged) - Human nuclear factor of activated T-cells 5, tonicity-responsive (NFAT5), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
NFAT5 (GFP-tagged) - Human nuclear factor of activated T-cells 5, tonicity-responsive (NFAT5), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
NFAT5 (GFP-tagged) - Human nuclear factor of activated T-cells 5, tonicity-responsive (NFAT5), transcript variant 6
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
NFAT5 (GFP-tagged) - Homo sapiens nuclear factor of activated T-cells 5, tonicity-responsive (NFAT5), transcript variant 5
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of NFAT5 (mGFP-tagged)-Human nuclear factor of activated T-cells 5, tonicity-responsive (NFAT5), transcript variant 1
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Lenti-ORF clone of NFAT5 (mGFP-tagged)-Human nuclear factor of activated T-cells 5, tonicity-responsive (NFAT5), transcript variant 1
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Rabbit Polyclonal Anti-NFAT5 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NFAT5 antibody: synthetic peptide directed towards the middle region of human NFAT5. Synthetic peptide located within the following region: PGQPQNEGQPPVTTLLSQQMPENSPLASSINTNQNIEKIDLLVSLQNQGN |
Transient overexpression lysate of nuclear factor of activated T-cells 5, tonicity-responsive (NFAT5), transcript variant 6
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Lenti-ORF clone of NFAT5 (Myc-DDK-tagged)-Human nuclear factor of activated T-cells 5, tonicity-responsive (NFAT5), transcript variant 1
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Lenti ORF clone of Human nuclear factor of activated T-cells 5, tonicity-responsive (NFAT5), transcript variant 6, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Lenti ORF clone of Human nuclear factor of activated T-cells 5, tonicity-responsive (NFAT5), transcript variant 6, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
NFAT5 (untagged)-Human nuclear factor of activated T-cells 5, tonicity-responsive (NFAT5), transcript variant 1
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
NFAT5 (untagged)-Human nuclear factor of activated T-cells 5, tonicity-responsive (NFAT5), transcript variant 6
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Rabbit polyclonal NFAT5/TonEBP (Ser155) antibody(Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human NFAT5/TonEBP around the phosphorylation site of serine 155 (D-N-SP-R-M). |
Modifications | Phospho-specific |
NFAT5 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
NFAT5 (untagged)-Human nuclear factor of activated T-cells 5, tonicity-responsive (NFAT5), transcript variant 4
Vector | pCMV6 series |
Tag | Tag Free |
NFAT5 (untagged)-Human nuclear factor of activated T-cells 5, tonicity-responsive (NFAT5), transcript variant 3
Vector | pCMV6 series |
Tag | Tag Free |
NFAT5 (untagged)-Human nuclear factor of activated T-cells 5, tonicity-responsive (NFAT5), transcript variant 2
Vector | pCMV6 series |
Tag | Tag Free |
NFAT5 (untagged) - Homo sapiens nuclear factor of activated T-cells 5, tonicity-responsive (NFAT5), transcript variant 5
Vector | pCMV6 series |
Tag | Tag Free |