Products

cDNA Clones (12)
Proteins (7)
Antibodies (6)
Jump to Filters
View as table Download
MCM6 (NM_005915) Human Tagged ORF Clone
RC207097

USD 610.00

In Stock

MCM6 (Myc-DDK-tagged)-Human minichromosome maintenance complex component 6 (MCM6)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
MCM6 (NM_005915) Human Tagged ORF Clone Lentiviral Particle
RC207097L1V

USD 1,010.00

3 Weeks

Lenti ORF particles, MCM6 (Myc-DDK tagged) - Human minichromosome maintenance complex component 6 (MCM6), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
MCM6 (NM_005915) Human Tagged ORF Clone Lentiviral Particle
RC207097L2V

USD 1,010.00

6 Weeks

Lenti ORF particles, MCM6 (mGFP-tagged) - Human minichromosome maintenance complex component 6 (MCM6), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
MCM6 (NM_005915) Human Tagged ORF Clone
RC207097L3

USD 810.00

3 Weeks

Lenti ORF clone of Human minichromosome maintenance complex component 6 (MCM6), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
MCM6 (NM_005915) Human Tagged ORF Clone Lentiviral Particle
RC207097L3V

USD 1,010.00

6 Weeks

Lenti ORF particles, MCM6 (Myc-DDK tagged) - Human minichromosome maintenance complex component 6 (MCM6), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
MCM6 (NM_005915) Human Tagged ORF Clone
RC207097L4

USD 810.00

3 Weeks

Lenti ORF clone of Human minichromosome maintenance complex component 6 (MCM6), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
MCM6 (NM_005915) Human Tagged ORF Clone Lentiviral Particle
RC207097L4V

USD 1,010.00

6 Weeks

Lenti ORF particles, MCM6 (mGFP-tagged) - Human minichromosome maintenance complex component 6 (MCM6), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
MCM6 (NM_005915) Human Tagged ORF Clone
RG207097

USD 670.00

3 Weeks

MCM6 (GFP-tagged) - Human minichromosome maintenance complex component 6 (MCM6)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
MCM6 Rabbit Polyclonal Antibody
TA349393

USD 380.00

In Stock

Rabbit Polyclonal Anti-MCM6 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human MCM6
MCM6 Rabbit Polyclonal Antibody
TA327220

USD 275.00

3 Weeks

Rabbit anti-MCM6 Polyclonal Antibody

Applications ICC/IF, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human MCM6
MCM6 (NM_005915) Human Untagged Clone
SC110945

USD 760.00

In Stock

MCM6 (untagged)-Human minichromosome maintenance complex component 6 (MCM6)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
MCM6 (NM_005915) Human Untagged Clone
SC323955

USD 760.00

In Stock

MCM6 (untagged)-Human minichromosome maintenance complex component 6 (MCM6)

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
MCM6 Rabbit Polyclonal Antibody
TA590213

USD 409.00

In Stock

Rabbit Polyclonal MCM6 Antibody

Applications ELISA, IHC, WB
Reactivities Human, Monkey, Mouse, Dog
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.
MCM6 (NM_005915) Human Tagged ORF Clone
RC207097L1

USD 810.00

In Stock

Lenti ORF clone of Human minichromosome maintenance complex component 6 (MCM6), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
MCM6 (NM_005915) Human Tagged ORF Clone
RC207097L2

USD 810.00

3 Weeks

Lenti ORF clone of Human minichromosome maintenance complex component 6 (MCM6), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
MCM6 (N-term) Rabbit Polyclonal Antibody
AP52640PU-N

USD 450.00

2 Weeks

MCM6 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 80-109 amino acids from the N-terminal region of Human MCM6.
MCM6 (NM_005915) Human Over-expression Lysate
LC401786

USD 121.00

In Stock

MCM6 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
MCM6 (NM_005915) Human Over-expression Lysate
LY401786

USD 396.00

In Stock

Transient overexpression lysate of minichromosome maintenance complex component 6 (MCM6)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
MCM6 Rabbit Polyclonal Antibody
TA341685

USD 375.00

5 Days

Rabbit Polyclonal Anti-MCM6 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MCM6 antibody: synthetic peptide directed towards the C terminal of human MCM6. Synthetic peptide located within the following region: RIIEKVIHRLTHYDHVLIELTQAGLKGSTEGSESYEEDPYLVVNPNYLLE
MCM6 Rabbit Polyclonal Antibody
TA341686

USD 310.00

5 Days

Rabbit Polyclonal Anti-MCM6 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MCM6 antibody: synthetic peptide directed towards the C terminal of human MCM6. Synthetic peptide located within the following region: RIIEKVIHRLTHYDHVLIELTQAGLKGSTEGSESYEEDPYLVVNPNYLLE
MCM6 (NM_005915) Human Mass Spec Standard
PH307097

USD 2,055.00

3 Weeks

MCM6 MS Standard C13 and N15-labeled recombinant protein (NP_005906)

Tag C-Myc/DDK
Expression Host HEK293
MCM6 (NM_005915) ICC Control Block
TB407097

USD 1,260.00

4 Weeks

Transient overexpression of MCM6 (NM_005915) in HEK293T cells paraffin embedded controls for ICC/IHC staining

MCM6 Cytosection
TS407097

USD 225.00

4 Weeks

Transient overexpression of MCM6 (NM_005915) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

MCM6 Cytosection
TS407097P5

USD 889.00

4 Weeks

Transient overexpression of MCM6 (NM_005915) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack