Germany
Japan
United Kingdom
China
MCM6 (Myc-DDK-tagged)-Human minichromosome maintenance complex component 6 (MCM6)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Recombinant protein of human minichromosome maintenance complex component 6 (MCM6)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Lenti ORF particles, MCM6 (Myc-DDK tagged) - Human minichromosome maintenance complex component 6 (MCM6), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, MCM6 (mGFP-tagged) - Human minichromosome maintenance complex component 6 (MCM6), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Mcm6 (Myc-DDK-tagged) - Mouse minichromosome maintenance deficient 6 (MIS5 homolog, S. pombe) (S. cerevisiae) (Mcm6)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
MCM6 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN407097 is the updated version of KN207097.
Mcm6 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN509877 is the updated version of KN309877.
Mcm6 (GFP-tagged) - Mouse minichromosome maintenance deficient 6 (MIS5 homolog, S. pombe) (S. cerevisiae) (Mcm6)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Mcm6 (Myc-DDK-tagged) - Mouse minichromosome maintenance deficient 6 (MIS5 homolog, S. pombe) (S. cerevisiae) (Mcm6)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Mcm6 (Myc-DDK-tagged) - Mouse minichromosome maintenance deficient 6 (MIS5 homolog, S. pombe) (S. cerevisiae) (Mcm6), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Mcm6 (mGFP-tagged) - Mouse minichromosome maintenance deficient 6 (MIS5 homolog, S. pombe) (S. cerevisiae) (Mcm6)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Mcm6 (GFP-tagged) - Mouse minichromosome maintenance deficient 6 (MIS5 homolog, S. pombe) (S. cerevisiae) (Mcm6), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human minichromosome maintenance complex component 6 (MCM6), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, MCM6 (Myc-DDK tagged) - Human minichromosome maintenance complex component 6 (MCM6), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human minichromosome maintenance complex component 6 (MCM6), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, MCM6 (mGFP-tagged) - Human minichromosome maintenance complex component 6 (MCM6), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
MCM6 (GFP-tagged) - Human minichromosome maintenance complex component 6 (MCM6)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Mcm6 (Myc-DDK-tagged ORF) - Rat minichromosome maintenance complex component 6 (Mcm6), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Mcm6 (Myc-DDK-tagged ORF) - Rat minichromosome maintenance complex component 6 (Mcm6), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Mcm6 (Myc-DDK-tagged ORF) - Rat minichromosome maintenance complex component 6 (Mcm6), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Mcm6 (mGFP-tagged ORF) - Rat minichromosome maintenance complex component 6 (Mcm6), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Mcm6 (GFP-tagged ORF) - Rat minichromosome maintenance complex component 6 (Mcm6), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Mcm6 - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
MCM6 (untagged)-Human minichromosome maintenance complex component 6 (MCM6)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
MCM6 (untagged)-Human minichromosome maintenance complex component 6 (MCM6)
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
qSTAR qPCR primer pairs against Homo sapiens gene MCM6
Lenti ORF clone of Human minichromosome maintenance complex component 6 (MCM6), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human minichromosome maintenance complex component 6 (MCM6), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
MCM6 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Transient overexpression lysate of minichromosome maintenance complex component 6 (MCM6)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit Polyclonal Anti-MCM6 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MCM6 antibody: synthetic peptide directed towards the C terminal of human MCM6. Synthetic peptide located within the following region: RIIEKVIHRLTHYDHVLIELTQAGLKGSTEGSESYEEDPYLVVNPNYLLE |
Rabbit Polyclonal Anti-MCM6 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MCM6 antibody: synthetic peptide directed towards the C terminal of human MCM6. Synthetic peptide located within the following region: RIIEKVIHRLTHYDHVLIELTQAGLKGSTEGSESYEEDPYLVVNPNYLLE |
MCM6 CRISPRa kit - CRISPR gene activation of human minichromosome maintenance complex component 6
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Mcm6 CRISPRa kit - CRISPR gene activation of mouse minichromosome maintenance complex component 6
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene MCM6
| Application | Plasmid of exact quantity for transcript copy number calculation |
Mcm6 (untagged) - Mouse minichromosome maintenance deficient 6 (MIS5 homolog, S. pombe) (S. cerevisiae) (Mcm6), (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
qSTAR qPCR primer pairs against Mus musculus gene Mcm6
MCM6 MS Standard C13 and N15-labeled recombinant protein (NP_005906)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Mcm6 (untagged ORF) - Rat minichromosome maintenance complex component 6 (Mcm6), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
3`UTR clone of minichromosome maintenance complex component 6 (MCM6) for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
MCM6 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Mcm6 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Mcm6 (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
MCM6 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human MCM6 |
MCM6 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human MCM6 |
Active filters
Target Symbol
- MCM6