Products

Antibodies (43)

cDNA Clones (27)

Proteins (19)

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 50 of 89 results

Page 1 of 2

(reset)

ARFGAP1 (NM_018209) Human Tagged ORF Clone

RC215268

USD 420.00

In Stock

ARFGAP1 (Myc-DDK-tagged)-Human ADP-ribosylation factor GTPase activating protein 1 (ARFGAP1), transcript variant 1

Vector	pCMV6-Entry
Tag	Myc-DDK
Mammalian Cell Selection	Neomycin

• 

1 / 2

2 / 2

Previous Next

ARFGAP1 (NM_175609) Human Tagged ORF Clone

RC206987

USD 420.00

In Stock

ARFGAP1 (Myc-DDK-tagged)-Human ADP-ribosylation factor GTPase activating protein 1 (ARFGAP1), transcript variant 2

Vector	pCMV6-Entry
Tag	Myc-DDK
Mammalian Cell Selection	Neomycin

• 

1 / 2

2 / 2

Previous Next

ARFGAP1 (NM_175609) Human Recombinant Protein

TP306987

USD 823.00

In Stock

Recombinant protein of human ADP-ribosylation factor GTPase activating protein 1 (ARFGAP1), transcript variant 2

Tag	C-Myc/DDK
Expression Host	HEK293T

• 

Special Offer: Get a 20% discount on this product. Use code: "MVPro20".

ARFGAP1 (NM_018209) Human Tagged ORF Clone Lentiviral Particle

RC215268L1V

USD 820.00

3 Weeks

Lenti ORF particles, ARFGAP1 (Myc-DDK tagged) - Human ADP-ribosylation factor GTPase activating protein 1 (ARFGAP1), transcript variant 1, 200ul, >10^7 TU/mL

Vector	pLenti-C-Myc-DDK
Tag	Myc-DDK

• LentiORF^®
• 

ARFGAP1 (NM_018209) Human Tagged ORF Clone Lentiviral Particle

RC215268L2V

USD 820.00

6 Weeks

Lenti ORF particles, ARFGAP1 (mGFP-tagged) - Human ADP-ribosylation factor GTPase activating protein 1 (ARFGAP1), transcript variant 1, 200ul, >10^7 TU/mL

Vector	pLenti-C-mGFP
Tag	mGFP

• LentiORF^®
• 

ARFGAP1 (NM_018209) Human Tagged ORF Clone

RG215268

USD 460.00

In Stock

ARFGAP1 (GFP-tagged) - Human ADP-ribosylation factor GTPase activating protein 1 (ARFGAP1), transcript variant 1

Vector	pCMV6-AC-GFP
Tag	TurboGFP
Mammalian Cell Selection	Neomycin

• TrueORF^®

ARFGAP1 (NM_175609) Human Tagged ORF Clone

RG206987

USD 460.00

In Stock

ARFGAP1 (GFP-tagged) - Human ADP-ribosylation factor GTPase activating protein 1 (ARFGAP1), transcript variant 2

Vector	pCMV6-AC-GFP
Tag	TurboGFP
Mammalian Cell Selection	Neomycin

• TrueORF^®

ARFGAP1 (NM_175609) Human Tagged ORF Clone

RC206987L3

USD 620.00

3 Weeks

Lenti ORF clone of Human ADP-ribosylation factor GTPase activating protein 1 (ARFGAP1), transcript variant 2, Myc-DDK-tagged

Vector	pLenti-C-Myc-DDK-P2A-Puro
Tag	Myc-DDK
Mammalian Cell Selection	Puromycin

• LentiORF^®

ARFGAP1 (NM_175609) Human Tagged ORF Clone Lentiviral Particle

RC206987L3V

USD 820.00

6 Weeks

Lenti ORF particles, ARFGAP1 (Myc-DDK tagged) - Human ADP-ribosylation factor GTPase activating protein 1 (ARFGAP1), transcript variant 2, 200ul, >10^7 TU/mL

Vector	pLenti-C-Myc-DDK-P2A-Puro
Tag	Myc-DDK
Mammalian Cell Selection	Puromycin

• LentiORF^®
• 

ARFGAP1 (NM_175609) Human Tagged ORF Clone

RC206987L4

USD 620.00

3 Weeks

Lenti ORF clone of Human ADP-ribosylation factor GTPase activating protein 1 (ARFGAP1), transcript variant 2, mGFP tagged

Vector	pLenti-C-mGFP-P2A-Puro
Tag	mGFP
Mammalian Cell Selection	Puromycin

• LentiORF^®

ARFGAP1 (NM_175609) Human Tagged ORF Clone Lentiviral Particle

RC206987L4V

USD 820.00

6 Weeks

Lenti ORF particles, ARFGAP1 (mGFP-tagged) - Human ADP-ribosylation factor GTPase activating protein 1 (ARFGAP1), transcript variant 2, 200ul, >10^7 TU/mL

Vector	pLenti-C-mGFP-P2A-Puro
Tag	mGFP
Mammalian Cell Selection	Puromycin

• LentiORF^®
• 

ARFGAP1 (NM_018209) Human Tagged ORF Clone

RC215268L3

USD 620.00

3 Weeks

Lenti ORF clone of Human ADP-ribosylation factor GTPase activating protein 1 (ARFGAP1), transcript variant 1, Myc-DDK-tagged

Vector	pLenti-C-Myc-DDK-P2A-Puro
Tag	Myc-DDK
Mammalian Cell Selection	Puromycin

• LentiORF^®

ARFGAP1 (NM_018209) Human Tagged ORF Clone Lentiviral Particle

RC215268L3V

USD 820.00

5 Weeks

Lenti ORF particles, ARFGAP1 (Myc-DDK tagged) - Human ADP-ribosylation factor GTPase activating protein 1 (ARFGAP1), transcript variant 1, 200ul, >10^7 TU/mL

Vector	pLenti-C-Myc-DDK-P2A-Puro
Tag	Myc-DDK
Mammalian Cell Selection	Puromycin

• LentiORF^®
• 

ARFGAP1 (NM_018209) Human Tagged ORF Clone

RC215268L4

USD 620.00

3 Weeks

Lenti ORF clone of Human ADP-ribosylation factor GTPase activating protein 1 (ARFGAP1), transcript variant 1, mGFP tagged

Vector	pLenti-C-mGFP-P2A-Puro
Tag	mGFP
Mammalian Cell Selection	Puromycin

• LentiORF^®

ARFGAP1 (NM_018209) Human Tagged ORF Clone Lentiviral Particle

RC215268L4V

USD 820.00

7 Weeks

Lenti ORF particles, ARFGAP1 (mGFP-tagged) - Human ADP-ribosylation factor GTPase activating protein 1 (ARFGAP1), transcript variant 1, 200ul, >10^7 TU/mL

Vector	pLenti-C-mGFP-P2A-Puro
Tag	mGFP
Mammalian Cell Selection	Puromycin

• LentiORF^®
• 

ARFGAP1 (NM_001281484) Human Tagged ORF Clone

RC237250

USD 420.00

2 Weeks

ARFGAP1 (myc-DDK-tagged) - Human ADP-ribosylation factor GTPase activating protein 1 (ARFGAP1), transcript variant 5

Vector	pCMV6-Entry
Tag	Myc-DDK
Mammalian Cell Selection	Neomycin

• TrueORF^®

ARFGAP1 (NM_001281483) Human Tagged ORF Clone

RC237721

USD 420.00

2 Weeks

ARFGAP1 (myc-DDK-tagged) - Human ADP-ribosylation factor GTPase activating protein 1 (ARFGAP1), transcript variant 4

Vector	pCMV6-Entry
Tag	Myc-DDK
Mammalian Cell Selection	Neomycin

• TrueORF^®

ARFGAP1 (NM_001281482) Human Tagged ORF Clone

RC238005

USD 420.00

2 Weeks

ARFGAP1 (myc-DDK-tagged) - Human ADP-ribosylation factor GTPase activating protein 1 (ARFGAP1), transcript variant 3

Vector	pCMV6-Entry
Tag	Myc-DDK
Mammalian Cell Selection	Neomycin

• TrueORF^®

ARFGAP1 (NM_018209) Human Untagged Clone

SC110523

USD 690.00

In Stock

ARFGAP1 (untagged)-Human ADP-ribosylation factor GTPase activating protein 1 (ARFGAP1), transcript variant 1

Vector	pCMV6-XL6
Tag	Tag Free
Mammalian Cell Selection	None

ARFGAP1 (NM_018209) Human Tagged ORF Clone

RC215268L1

USD 768.00

In Stock

Lenti ORF clone of Human ADP-ribosylation factor GTPase activating protein 1 (ARFGAP1), transcript variant 1, Myc-DDK-tagged

Vector	pLenti-C-Myc-DDK
Tag	Myc-DDK
Mammalian Cell Selection	None

• LentiORF^®

1 / 2

2 / 2

Previous Next

ARFGAP1 (NM_175609) Human Untagged Clone

SC126067

USD 310.00

In Stock

ARFGAP1 (untagged)-Human ADP-ribosylation factor GTPase activating protein 1 (ARFGAP1), transcript variant 2

Vector	pCMV6-XL5
Tag	Tag Free
Mammalian Cell Selection	None

ARFGAP1 Rabbit Polyclonal Antibody

TA344909

USD 475.00

5 Days

Rabbit Polyclonal Anti-ARFGAP1 Antibody - middle region

Applications	WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-ARFGAP1 antibody: synthetic peptide directed towards the middle region of human ARFGAP1. Synthetic peptide located within the following region: WRDVTTFFSGKAEGPLDSPSEGHSYQNSGLDHFQNSNIDQSFWETFGSAE

ARFGAP1 Rabbit Polyclonal Antibody

TA344910

USD 475.00

5 Days

Rabbit Polyclonal Anti-ARFGAP1 Antibody - middle region

Applications	WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-ARFGAP1 antibody: synthetic peptide directed towards the middle region of human ARFGAP1. Synthetic peptide located within the following region: GQPQSVTASSDKAFEDWLNDDLGSYQGAQGNRYVGFGNTPPPQKKEDDFL

ARFGAP1 (NM_018209) Human Tagged ORF Clone

RC215268L2

USD 620.00

3 Weeks

Lenti ORF clone of Human ADP-ribosylation factor GTPase activating protein 1 (ARFGAP1), transcript variant 1, mGFP tagged

Vector	pLenti-C-mGFP
Tag	mGFP
Mammalian Cell Selection	None

• LentiORF^®

ARFGAP1 (NM_175609) Human Over-expression Lysate

LC406240

USD 121.00

In Stock

ARFGAP1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag	C-Myc/DDK
Expression Host	HEK293T
Applications	WB

ARFGAP1 (NM_018209) Human Over-expression Lysate

LY413218

USD 396.00

5 Days

Transient overexpression lysate of ADP-ribosylation factor GTPase activating protein 1 (ARFGAP1), transcript variant 1

Tag	C-Myc/DDK
Expression Host	HEK293T
Applications	WB

ARFGAP1 Mouse Monoclonal Antibody [Clone ID: OTI1H6]

CF502531

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ARFGAP1 mouse monoclonal antibody, clone OTI1H6 (formerly 1H6)

Applications	FC, IF, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

ARFGAP1 Mouse Monoclonal Antibody [Clone ID: OTI2C6]

CF502591

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ARFGAP1 mouse monoclonal antibody, clone OTI2C6 (formerly 2C6)

Applications	FC, IF, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

ARFGAP1 Mouse Monoclonal Antibody [Clone ID: OTI1F9]

CF502592

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ARFGAP1 mouse monoclonal antibody, clone OTI1F9 (formerly 1F9)

Applications	FC, IF, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

ARFGAP1 Mouse Monoclonal Antibody [Clone ID: OTI1F6]

CF502593

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ARFGAP1 mouse monoclonal antibody, clone OTI1F6 (formerly 1F6)

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 16

2 / 16

3 / 16

4 / 16

5 / 16

6 / 16

7 / 16

8 / 16

9 / 16

10 / 16

11 / 16

12 / 16

13 / 16

14 / 16

15 / 16

16 / 16

Previous Next

ARFGAP1 Mouse Monoclonal Antibody [Clone ID: OTI1H4]

CF502594

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ARFGAP1 mouse monoclonal antibody, clone OTI1H4 (formerly 1H4)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

ARFGAP1 Mouse Monoclonal Antibody [Clone ID: OTI2C5]

CF502626

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ARFGAP1 mouse monoclonal antibody, clone OTI2C5 (formerly 2C5)

Applications	FC, IF, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

ARFGAP1 Mouse Monoclonal Antibody [Clone ID: OTI 2C10]

CF502635

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ARFGAP1 mouse monoclonal antibody, clone OTI 2C10 (formerly 2C10)

Applications	FC, IF, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

ARFGAP1 Mouse Monoclonal Antibody [Clone ID: OTI2D5]

CF502691

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ARFGAP1 mouse monoclonal antibody, clone OTI2D5 (formerly 2D5)

Applications	FC, IF, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

ARFGAP1 (NM_018209) Human Over-expression Lysate

LC413218

USD 121.00

2 Weeks

ARFGAP1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag	C-Myc/DDK
Expression Host	HEK293T
Applications	WB

ARFGAP1 (NM_175609) Human Over-expression Lysate

LY406240

USD 396.00

5 Days

Transient overexpression lysate of ADP-ribosylation factor GTPase activating protein 1 (ARFGAP1), transcript variant 2

Tag	C-Myc/DDK
Expression Host	HEK293T
Applications	WB

ARFGAP1 (NM_175609) Human Mass Spec Standard

PH306987

USD 2,055.00

3 Weeks

ARFGAP1 MS Standard C13 and N15-labeled recombinant protein (NP_783202)

Tag	C-Myc/DDK
Expression Host	HEK293

ARFGAP1 (NM_018209) Human Mass Spec Standard

PH315268

USD 2,055.00

3 Weeks

ARFGAP1 MS Standard C13 and N15-labeled recombinant protein (NP_060679)

Tag	C-Myc/DDK
Expression Host	HEK293

ARFGAP1 (NM_001281484) Human Tagged ORF Clone

RG237250

USD 460.00

2 Weeks

ARFGAP1 (GFP-tagged) - Human ADP-ribosylation factor GTPase activating protein 1 (ARFGAP1), transcript variant 5

Vector	pCMV6-AC-GFP
Tag	TurboGFP
Mammalian Cell Selection	Neomycin

• TrueORF^®

ARFGAP1 (NM_001281483) Human Tagged ORF Clone

RG237721

USD 460.00

2 Weeks

ARFGAP1 (GFP-tagged) - Human ADP-ribosylation factor GTPase activating protein 1 (ARFGAP1), transcript variant 4

Vector	pCMV6-AC-GFP
Tag	TurboGFP
Mammalian Cell Selection	Neomycin

• TrueORF^®

ARFGAP1 (NM_001281482) Human Tagged ORF Clone

RG238005

USD 460.00

2 Weeks

ARFGAP1 (GFP-tagged) - Human ADP-ribosylation factor GTPase activating protein 1 (ARFGAP1), transcript variant 3

Vector	pCMV6-AC-GFP
Tag	TurboGFP
Mammalian Cell Selection	Neomycin

• TrueORF^®

ARFGAP1 (NM_001281484) Human Untagged Clone

SC335144

USD 477.00

2 Weeks

ARFGAP1 (untagged) - Human ADP-ribosylation factor GTPase activating protein 1 (ARFGAP1), transcript variant 5

Vector	pCMV6-Entry
Tag	Tag Free
Mammalian Cell Selection	Neomycin

ARFGAP1 (NM_001281483) Human Untagged Clone

SC335615

USD 370.00

2 Weeks

ARFGAP1 (untagged) - Human ADP-ribosylation factor GTPase activating protein 1 (ARFGAP1), transcript variant 4

Vector	pCMV6-Entry
Tag	Tag Free
Mammalian Cell Selection	Neomycin

ARFGAP1 (NM_001281482) Human Untagged Clone

SC335899

USD 400.00

2 Weeks

ARFGAP1 (untagged) - Human ADP-ribosylation factor GTPase activating protein 1 (ARFGAP1), transcript variant 3

Vector	pCMV6-Entry
Tag	Tag Free
Mammalian Cell Selection	Neomycin

ARFGAP1 Rabbit Polyclonal Antibody

TA349499

USD 345.00

In Stock

Rabbit Polyclonal Anti-ARFGAP1 Antibody

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	Fusion protein of human ARFGAP1

1 / 3

2 / 3

3 / 3

Previous Next

ARFGAP1 Mouse Monoclonal Antibody [Clone ID: OTI1H6]

TA502531

USD 379.00

In Stock

ARFGAP1 mouse monoclonal antibody, clone OTI1H6 (formerly 1H6)

Applications	FC, IF, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

ARFGAP1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1H6]

TA502531AM

USD 420.00

4 Weeks

ARFGAP1 mouse monoclonal antibody, clone OTI1H6 (formerly 1H6), Biotinylated

Applications	FC, IF, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	Biotin

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

ARFGAP1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1H6]

TA502531BM

USD 420.00

4 Weeks

ARFGAP1 mouse monoclonal antibody, clone OTI1H6 (formerly 1H6), HRP conjugated

Applications	FC, IF, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	HRP

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

ARFGAP1 Mouse Monoclonal Antibody [Clone ID: OTI1H6]

TA502531S

USD 159.00

2 Days

ARFGAP1 mouse monoclonal antibody, clone OTI1H6 (formerly 1H6)

Applications	FC, IF, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

ARFGAP1 Mouse Monoclonal Antibody [Clone ID: OTI2C6]

TA502591

USD 379.00

In Stock

ARFGAP1 mouse monoclonal antibody, clone OTI2C6 (formerly 2C6)

Applications	FC, IF, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

1 - 50 of 89 results

Page 1 of 2