Products

cDNA Clones (31)
Proteins (18)
Antibodies (4)
Jump to Filters
View as table Download
Beta Arrestin 2 (ARRB2) (NM_004313) Human Tagged ORF Clone
RG201168

USD 460.00

In Stock

ARRB2 (GFP-tagged) - Human arrestin, beta 2 (ARRB2), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Beta Arrestin 2 (ARRB2) (NM_004313) Human Tagged ORF Clone
RC201168

USD 420.00

In Stock

ARRB2 (Myc-DDK-tagged)-Human arrestin, beta 2 (ARRB2), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Beta Arrestin 2 (ARRB2) (NM_004313) Human Untagged Clone
SC108950

USD 310.00

In Stock

ARRB2 (untagged)-Human arrestin, beta 2 (ARRB2), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
Beta Arrestin 2 (ARRB2) (NM_199004) Human Tagged ORF Clone
RC212960

USD 420.00

In Stock

ARRB2 (Myc-DDK-tagged)-Human arrestin, beta 2 (ARRB2), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Beta Arrestin 2 (ARRB2) (NM_199004) Human Tagged ORF Clone
RG212960

USD 460.00

In Stock

ARRB2 (GFP-tagged) - Human arrestin, beta 2 (ARRB2), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Beta Arrestin 2 (ARRB2) (NM_001257328) Human Tagged ORF Clone
RG234077

USD 500.00

In Stock

ARRB2 (GFP-tagged) - Homo sapiens arrestin, beta 2 (ARRB2), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Beta Arrestin 2 (ARRB2) (NM_004313) Human Tagged ORF Clone Lentiviral Particle
RC201168L3V

USD 820.00

5 Weeks

Lenti ORF particles, ARRB2 (Myc-DDK tagged) - Human arrestin, beta 2 (ARRB2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Beta Arrestin 2 (ARRB2) (NM_199004) Human Tagged ORF Clone Lentiviral Particle
RC212960L3V

USD 820.00

7 Weeks

Lenti ORF particles, ARRB2 (Myc-DDK tagged) - Human arrestin, beta 2 (ARRB2), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Beta Arrestin 2 (ARRB2) (NM_001257329) Human Tagged ORF Clone
RC233785

USD 420.00

3 Weeks

ARRB2 (Myc-DDK tagged) - Homo sapiens arrestin, beta 2 (ARRB2), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Beta Arrestin 2 (ARRB2) (NM_001257331) Human Tagged ORF Clone
RC234006

USD 420.00

5 Weeks

ARRB2 (Myc-DDK tagged) - Homo sapiens arrestin, beta 2 (ARRB2), transcript variant 6

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Beta Arrestin 2 (ARRB2) (NM_001257330) Human Tagged ORF Clone
RC234049

USD 420.00

5 Weeks

ARRB2 (Myc-DDK tagged) - Homo sapiens arrestin, beta 2 (ARRB2), transcript variant 5

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Beta Arrestin 2 (ARRB2) (NM_001257328) Human Tagged ORF Clone
RC234077

USD 450.00

3 Weeks

ARRB2 (Myc-DDK tagged) - Homo sapiens arrestin, beta 2 (ARRB2), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Beta Arrestin 2 (ARRB2) (NM_001257329) Human Tagged ORF Clone
RG233785

USD 460.00

3 Weeks

ARRB2 (GFP-tagged) - Homo sapiens arrestin, beta 2 (ARRB2), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Beta Arrestin 2 (ARRB2) (NM_001257331) Human Tagged ORF Clone
RG234006

USD 460.00

5 Weeks

ARRB2 (GFP-tagged) - Homo sapiens arrestin, beta 2 (ARRB2), transcript variant 6

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Beta Arrestin 2 (ARRB2) (NM_001257330) Human Tagged ORF Clone
RG234049

USD 460.00

5 Weeks

ARRB2 (GFP-tagged) - Homo sapiens arrestin, beta 2 (ARRB2), transcript variant 5

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Beta Arrestin 2 (ARRB2) Rabbit Polyclonal Antibody
TA346492

USD 475.00

5 Days

Rabbit Polyclonal Anti-ARRB2 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-ARRB2 antibody: synthetic peptide directed towards the middle region of human ARRB2. Synthetic peptide located within the following region: RLVIRKVQFAPEKPGPQPSAETTRHFLMSDRSLHLEASLDKELYYHGEPL
Beta Arrestin 2 (ARRB2) (NM_199004) Human Tagged ORF Clone
RC212960L1

USD 620.00

In Stock

Lenti ORF clone of Human arrestin, beta 2 (ARRB2), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
Beta Arrestin 2 (ARRB2) (NM_199004) Human Untagged Clone
SC307849

USD 670.00

In Stock

ARRB2 (untagged)-Human arrestin, beta 2 (ARRB2), transcript variant 2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
Beta Arrestin 2 (ARRB2) (NM_199004) Human Over-expression Lysate
LY430785

USD 396.00

In Stock

Transient overexpression lysate of arrestin, beta 2 (ARRB2), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Beta Arrestin 2 (ARRB2) (NM_199004) Human Tagged ORF Clone
RC212960L2

USD 620.00

3 Weeks

Lenti ORF clone of Human arrestin, beta 2 (ARRB2), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
Beta Arrestin 2 (ARRB2) Rabbit Polyclonal Antibody
TA337007

USD 424.00

5 Days

Rabbit Polyclonal beta-Arrestin 2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Bovine, Canine, Equine, Primate
Conjugation Unconjugated
Immunogen A peptide sequence corresponding to an area between amino acids 1 and 50 of human ARRB2 was used as the immunogen for the antibody, Gen Bank no. gb:ABG47460.1.
Beta Arrestin 2 (ARRB2) Goat Polyclonal Antibody
TA303022

USD 375.00

5 Days

Goat Polyclonal Antibody against ARRB2

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide with sequence C-HDHIPLPRPQS, from the internal region of the protein sequence according to NP_004304.1; NP_945355.1.
Beta Arrestin 2 (ARRB2) (NM_199004) Human Over-expression Lysate
LC404716

USD 121.00

2 Weeks

ARRB2 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Beta Arrestin 2 (ARRB2) (NM_199004) Human Over-expression Lysate
LC430785

USD 121.00

2 Weeks

ARRB2 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Beta Arrestin 2 (ARRB2) (NM_199004) Human Over-expression Lysate
LY404716

USD 396.00

5 Days

Transient overexpression lysate of arrestin, beta 2 (ARRB2), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
LY404716 is the same product as LY430785.
Beta Arrestin 2 (ARRB2) ICC Control Block
TB401168

USD 1,070.00

4 Weeks

Transient overexpression of ARRB2 (NM_004313) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Beta Arrestin 2 (ARRB2) ICC Control Block
TB412960

USD 1,070.00

4 Weeks

Transient overexpression of ARRB2 (NM_199004) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Beta Arrestin 2 (ARRB2) ICC Control Block
TB433785

USD 1,070.00

4 Weeks

Transient overexpression of ARRB2 (NM_001257329) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Beta Arrestin 2 (ARRB2) ICC Control Block
TB434006

USD 1,070.00

4 Weeks

Transient overexpression of ARRB2 (NM_001257331) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Beta Arrestin 2 (ARRB2) ICC Control Block
TB434049

USD 1,070.00

4 Weeks

Transient overexpression of ARRB2 (NM_001257330) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Beta Arrestin 2 (ARRB2) ICC Control Block
TB434077

USD 1,100.00

4 Weeks

Transient overexpression of ARRB2 (NM_001257328) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Beta Arrestin 2 (ARRB2) Cytosection
TS401168

USD 225.00

4 Weeks

Transient overexpression of ARRB2 (NM_004313) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Beta Arrestin 2 (ARRB2) Cytosection
TS401168P5

USD 889.00

4 Weeks

Transient overexpression of ARRB2 (NM_004313) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Beta Arrestin 2 (ARRB2) Cytosection
TS412960

USD 225.00

4 Weeks

Transient overexpression of ARRB2 (NM_199004) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Beta Arrestin 2 (ARRB2) Cytosection
TS412960P5

USD 889.00

4 Weeks

Transient overexpression of ARRB2 (NM_199004) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Beta Arrestin 2 (ARRB2) ICC Control Sections
TS433785P5

USD 889.00

4 Weeks

Transient overexpression of ARRB2 (NM_001257329) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack