Germany
Japan
United Kingdom
China
GRK4 (Myc-DDK-tagged)-Human G protein-coupled receptor kinase 4 (GRK4), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Lenti ORF particles, GRK4 (Myc-DDK tagged) - Human G protein-coupled receptor kinase 4 (GRK4), transcript variant 3, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, GRK4 (mGFP-tagged) - Human G protein-coupled receptor kinase 4 (GRK4), transcript variant 3, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Lenti ORF particles, GRK4 (Myc-DDK tagged) - Human G protein-coupled receptor kinase 4 (GRK4), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, GRK4 (mGFP-tagged) - Human G protein-coupled receptor kinase 4 (GRK4), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
GRK4 (Myc-DDK-tagged)-Human G protein-coupled receptor kinase 4 (GRK4), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
GRK4 (Myc-DDK-tagged)-Human G protein-coupled receptor kinase 4 (GRK4), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
GRK4 Mutant (R65L), Myc-DDK-tagged ORF clone of Homo sapiens G protein-coupled receptor kinase 4 (GRK4), transcript variant 1 as transfection-ready DNA
| Mutation | R65L |
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
GRK4 Mutant (A142V), Myc-DDK-tagged ORF clone of Homo sapiens G protein-coupled receptor kinase 4 (GRK4), transcript variant 1 as transfection-ready DNA
| Mutation | A142V |
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
GRK4 (GFP-tagged) - Human G protein-coupled receptor kinase 4 (GRK4), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
GRK4 Mutant (V486A), Myc-DDK-tagged ORF clone of Homo sapiens G protein-coupled receptor kinase 4 (GRK4), transcript variant 1 as transfection-ready DNA
| Mutation | V486A |
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human G protein-coupled receptor kinase 4 (GRK4), transcript variant 3, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, GRK4 (Myc-DDK tagged) - Human G protein-coupled receptor kinase 4 (GRK4), transcript variant 3, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human G protein-coupled receptor kinase 4 (GRK4), transcript variant 3, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, GRK4 (mGFP-tagged) - Human G protein-coupled receptor kinase 4 (GRK4), transcript variant 3, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human G protein-coupled receptor kinase 4 (GRK4), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, GRK4 (Myc-DDK tagged) - Human G protein-coupled receptor kinase 4 (GRK4), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human G protein-coupled receptor kinase 4 (GRK4), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, GRK4 (mGFP-tagged) - Human G protein-coupled receptor kinase 4 (GRK4), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of GRK4 (Myc-DDK-tagged)-Human G protein-coupled receptor kinase 4 (GRK4), transcript variant 2
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, GRK4 (Myc-DDK-tagged)-Human G protein-coupled receptor kinase 4 (GRK4), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of GRK4 (mGFP-tagged)-Human G protein-coupled receptor kinase 4 (GRK4), transcript variant 2
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, GRK4 (mGFP-tagged)-Human G protein-coupled receptor kinase 4 (GRK4), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
GRK4 (myc-DDK-tagged) - Human G protein-coupled receptor kinase 4 (GRK4), transcript variant 4
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
GRK4 (GFP-tagged) - Human G protein-coupled receptor kinase 4 (GRK4), transcript variant 3
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
GRK4 (GFP-tagged) - Human G protein-coupled receptor kinase 4 (GRK4), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human G protein-coupled receptor kinase 4 (GRK4), transcript variant 3, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human G protein-coupled receptor kinase 4 (GRK4), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
GRK4 (untagged)-Human G protein-coupled receptor kinase 4 (GRK4), transcript variant 1
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
SC310254 is the updated version of SC107606.
Transient overexpression lysate of G protein-coupled receptor kinase 4 (GRK4), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Lenti ORF clone of Human G protein-coupled receptor kinase 4 (GRK4), transcript variant 3, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human G protein-coupled receptor kinase 4 (GRK4), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Purified recombinant protein of Human G protein-coupled receptor kinase 4 (GRK4), transcript variant 1, Met1-Arg245, with N-terminal His tag, expressed in E.coli, 50ug
| Tag | N-His |
| Expression Host | E. coli |
GRK4 (untagged)-Human G protein-coupled receptor kinase 4 (GRK4), transcript variant 3
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-GRK4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-GRK4 Antibody: synthetic peptide directed towards the middle region of human GRK4. Synthetic peptide located within the following region: QSRFVVSLAYAYETKDALCLVLTIMNGGDLKFHIYNLGNPGFDEQRAVFY |
Rabbit Polyclonal Anti-GRK4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-GRK4 Antibody: synthetic peptide directed towards the middle region of human GRK4. Synthetic peptide located within the following region: EKVKWEEVDQRIKNDTEEYSEKFSEDAKSICRMLLTKNPSKRLGCRGEGA |
Carrier-free (BSA/glycerol-free) GRK4 mouse monoclonal antibody, clone OTI4F5 (formerly 4F5)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (glycerol/BSA-free) GRK4 mouse monoclonal antibody, clone OTI9A3 (formerly 9A3)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
GRK4 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
GRK4 MS Standard C13 and N15-labeled recombinant protein (NP_892027)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
GRK4 (GFP-tagged) - Human G protein-coupled receptor kinase 4 (GRK4), transcript variant 4
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
GRK4 (untagged)-Human G protein-coupled receptor kinase 4 (GRK4), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
GRK4 (untagged) - Human G protein-coupled receptor kinase 4 (GRK4), transcript variant 4
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Anti-GRK4 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 36-145 amino acids of human G protein-coupled receptor kinase 4 |
GRK4 mouse monoclonal antibody, clone OTI4F5 (formerly 4F5)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
GRK4 mouse monoclonal antibody, clone OTI4F5 (formerly 4F5), Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
GRK4 mouse monoclonal antibody, clone OTI4F5 (formerly 4F5), HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
GRK4 mouse monoclonal antibody, clone OTI4F5 (formerly 4F5)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
GRK4 mouse monoclonal antibody, clone OTI9A3 (formerly 9A3)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- GRK4
Pathways
- Endocytosis