PLD2 (GFP-tagged) - Human phospholipase D2 (PLD2)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
- TrueORF®
PLD2 (GFP-tagged) - Human phospholipase D2 (PLD2)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
PLD2 (Myc-DDK-tagged)-Human phospholipase D2 (PLD2)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
USD 1,150.00
3 Weeks
Lenti ORF particles, PLD2 (Myc-DDK-tagged)-Human phospholipase D2 (PLD2), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 1,150.00
6 Weeks
Lenti ORF particles, PLD2 (mGFP-tagged)-Human phospholipase D2 (PLD2), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Lenti-ORF clone of PLD2 (Myc-DDK-tagged)-Human phospholipase D2 (PLD2)
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 1,150.00
11 Weeks
Lenti ORF particles, PLD2 (Myc-DDK-tagged)-Human phospholipase D2 (PLD2), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of PLD2 (mGFP-tagged)-Human phospholipase D2 (PLD2)
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 1,150.00
11 Weeks
Lenti ORF particles, PLD2 (mGFP-tagged)-Human phospholipase D2 (PLD2), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
PLD2 (Myc-DDK tagged) - Homo sapiens phospholipase D2 (PLD2), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PLD2 (GFP-tagged) - Homo sapiens phospholipase D2 (PLD2), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
PLD2 (untagged)-Human phospholipase D2 (PLD2)
Vector | pCMV6-XL6 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Transient overexpression lysate of phospholipase D2 (PLD2)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
PLD2 (untagged)-Human phospholipase D2 (PLD2)
Vector | pCMV6-AC |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Rabbit polyclonal PLD2 (Tyr169) antibody(Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human PLD2 around the phosphorylation site of tyrosine 169 (E-N-YP-L-N). |
Modifications | Phospho-specific |
Rabbit polyclonal PLD2 (Ab-169) antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human PLD2. |
Lenti-ORF clone of PLD2 (mGFP-tagged)-Human phospholipase D2 (PLD2)
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
PLD2 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit Polyclonal Anti-PLD2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-PLD2 Antibody: synthetic peptide directed towards the N terminal of human PLD2. Synthetic peptide located within the following region: MTATPESLFPTGDELDSSQLQMESDEVDTLKEGEDPADRMHPFLAIYELQ |
Rabbit Polyclonal Anti-PLD2 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-PLD2 Antibody: synthetic peptide directed towards the middle region of human PLD2. Synthetic peptide located within the following region: DLHYRLTDLGDSSESAASQPPTPRPDSPATPDLSHNQFFWLGKDYSNLIT |
PLD2 (untagged) - Homo sapiens phospholipase D2 (PLD2), transcript variant 2
Vector | pCMV6 series |
Tag | Tag Free |
Transient overexpression of PLD2 (NM_002663) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PLD2 (NM_001243108) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PLD2 (NM_002663) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of PLD2 (NM_002663) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of PLD2 (NM_001243108) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack