Products

cDNA Clones (12)
Proteins (7)
Antibodies (1)
Jump to Filters
View as table Download
PKC iota (PRKCI) (NM_002740) Human Untagged Clone
SC118455

USD 310.00

In Stock

PRKCI (untagged)-Human protein kinase C, iota (PRKCI)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
PKC iota (PRKCI) (NM_002740) Human Recombinant Protein
TP305379

USD 823.00

In Stock

Recombinant protein of human protein kinase C, iota (PRKCI)

Tag C-Myc/DDK
Expression Host HEK293T
PKC iota (PRKCI) (NM_002740) Human Tagged ORF Clone
RG205379

USD 530.00

In Stock

PRKCI (GFP-tagged) - Human protein kinase C, iota (PRKCI)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PKC iota (PRKCI) (NM_002740) Human Untagged Clone
SC318027

USD 760.00

2 Weeks

PRKCI (untagged)-Human protein kinase C, iota (PRKCI)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
PKC iota (PRKCI) (NM_002740) Human Tagged ORF Clone
RC205379L2

USD 680.00

2 Weeks

Lenti ORF clone of Human protein kinase C, iota (PRKCI), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
PKC iota (PRKCI) (NM_002740) Human Untagged Clone
SC323672

USD 760.00

In Stock

PRKCI (untagged)-Kinase deficient mutant (K283M) of Human protein kinase C, iota (PRKCI)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
PKC iota (PRKCI) (NM_002740) Human Over-expression Lysate
LC400965

USD 121.00

In Stock

PRKCI HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
PKC iota (PRKCI) Rabbit Polyclonal Antibody
TA342150

USD 375.00

5 Days

Rabbit polyclonal Anti-PRKCI Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PRKCI antibody: synthetic peptide directed towards the middle region of human PRKCI. Synthetic peptide located within the following region: TVIPYNPSSHESLDQVGEEKEAMNTRESGKASSSLGLQDFDLLRVIGRGS
PKC iota (PRKCI) (NM_002740) Human Mass Spec Standard
PH305379

USD 2,055.00

3 Weeks

PRKCI MS Standard C13 and N15-labeled recombinant protein (NP_002731)

Tag C-Myc/DDK
Expression Host HEK293
PKC iota (PRKCI) ICC Control Block
TB405379

USD 1,130.00

4 Weeks

Transient overexpression of PRKCI (NM_002740) in HEK293T cells paraffin embedded controls for ICC/IHC staining

PKC iota (PRKCI) Cytosection
TS405379

USD 225.00

4 Weeks

Transient overexpression of PRKCI (NM_002740) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

PKC iota (PRKCI) Cytosection
TS405379P5

USD 889.00

4 Weeks

Transient overexpression of PRKCI (NM_002740) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack