USD 420.00
In Stock
SH3GL1 (Myc-DDK-tagged)-Human SH3-domain GRB2-like 1 (SH3GL1), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
USD 420.00
In Stock
SH3GL1 (Myc-DDK-tagged)-Human SH3-domain GRB2-like 1 (SH3GL1), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
USD 460.00
In Stock
SH3GL1 (GFP-tagged) - Human SH3-domain GRB2-like 1 (SH3GL1), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
USD 823.00
In Stock
Recombinant protein of human SH3-domain GRB2-like 1 (SH3GL1)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
USD 820.00
6 Weeks
Lenti ORF particles, SH3GL1 (mGFP-tagged) - Human SH3-domain GRB2-like 1 (SH3GL1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
USD 820.00
3 Weeks
Lenti ORF particles, SH3GL1 (Myc-DDK tagged) - Human SH3-domain GRB2-like 1 (SH3GL1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 620.00
3 Weeks
Lenti ORF clone of Human SH3-domain GRB2-like 1 (SH3GL1), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
5 Weeks
Lenti ORF particles, SH3GL1 (Myc-DDK tagged) - Human SH3-domain GRB2-like 1 (SH3GL1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 620.00
3 Weeks
Lenti ORF clone of Human SH3-domain GRB2-like 1 (SH3GL1), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
7 Weeks
Lenti ORF particles, SH3GL1 (mGFP-tagged) - Human SH3-domain GRB2-like 1 (SH3GL1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 420.00
3 Weeks
SH3GL1 (Myc-DDK tagged) - Homo sapiens SH3-domain GRB2-like 1 (SH3GL1), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
USD 420.00
3 Weeks
SH3GL1 (Myc-DDK tagged) - Homo sapiens SH3-domain GRB2-like 1 (SH3GL1), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
USD 460.00
3 Weeks
SH3GL1 (GFP-tagged) - Homo sapiens SH3-domain GRB2-like 1 (SH3GL1), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
USD 460.00
3 Weeks
SH3GL1 (GFP-tagged) - Homo sapiens SH3-domain GRB2-like 1 (SH3GL1), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
USD 310.00
In Stock
SH3GL1 (untagged)-Human SH3-domain GRB2-like 1 (SH3GL1), transcript variant 1
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
USD 410.00
2 Weeks
Mouse Monoclonal anti-SH3GL1 Antibody
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 768.00
In Stock
Lenti ORF clone of Human SH3-domain GRB2-like 1 (SH3GL1), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
USD 396.00
5 Days
Transient overexpression lysate of SH3-domain GRB2-like 1 (SH3GL1)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
USD 310.00
In Stock
SH3GL1 (untagged)-Human SH3-domain GRB2-like 1 (SH3GL1), transcript variant 1
Vector | pCMV6-AC |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
USD 121.00
In Stock
SH3GL1 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
USD 620.00
3 Weeks
Lenti ORF clone of Human SH3-domain GRB2-like 1 (SH3GL1), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Rabbit polyclonal antibody to SH3GL1 (SH3-domain GRB2-like 1)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 152 and 368 of EEN (Uniprot ID#Q99961) |
Rabbit polyclonal Anti-SH3GL1 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SH3GL1 antibody: synthetic peptide directed towards the N terminal of human SH3GL1. Synthetic peptide located within the following region: LNTVSKIRGQVKNPGYPQSEGLLGECMIRHGKELGGESNFGDALLDAGES |
USD 465.00
4 Weeks
Carrier-free (BSA/glycerol-free) SH3GL1 mouse monoclonal antibody, clone OTI2F5 (formerly 2F5)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 465.00
4 Weeks
Carrier-free (BSA/glycerol-free) SH3GL1 mouse monoclonal antibody, clone OTI3F8 (formerly 3F8)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 2,055.00
3 Weeks
SH3GL1 MS Standard C13 and N15-labeled recombinant protein (NP_003016)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
USD 330.00
3 Weeks
SH3GL1 (untagged) - Homo sapiens SH3-domain GRB2-like 1 (SH3GL1), transcript variant 2
Vector | pCMV6 series |
Tag | Tag Free |
USD 310.00
3 Weeks
SH3GL1 (untagged) - Homo sapiens SH3-domain GRB2-like 1 (SH3GL1), transcript variant 3
Vector | pCMV6 series |
Tag | Tag Free |
USD 379.00
In Stock
SH3GL1 mouse monoclonal antibody, clone OTI2F5 (formerly 2F5)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
SH3GL1 mouse monoclonal antibody, clone OTI2F5 (formerly 2F5), Biotinylated
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
SH3GL1 mouse monoclonal antibody, clone OTI2F5 (formerly 2F5), HRP conjugated
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
USD 159.00
In Stock
SH3GL1 mouse monoclonal antibody, clone OTI2F5 (formerly 2F5)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 379.00
In Stock
SH3GL1 mouse monoclonal antibody, clone OTI3F8 (formerly 3F8)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
SH3GL1 mouse monoclonal antibody, clone OTI3F8 (formerly 3F8), Biotinylated
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
SH3GL1 mouse monoclonal antibody, clone OTI3F8 (formerly 3F8), HRP conjugated
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
USD 159.00
2 Days
SH3GL1 mouse monoclonal antibody, clone OTI3F8 (formerly 3F8)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Transient overexpression of SH3GL1 (NM_003025) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of SH3GL1 (NM_001199944) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of SH3GL1 (NM_001199943) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of SH3GL1 (NM_003025) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of SH3GL1 (NM_003025) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of SH3GL1 (NM_001199944) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of SH3GL1 (NM_001199943) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack