Products

cDNA Clones (34)
Proteins (18)
Antibodies (3)
Jump to Filters
View as table Download
SH3KBP1 (NM_001024666) Human Tagged ORF Clone
RC215701

USD 98.00

USD 770.00

In Stock

SH3KBP1 (Myc-DDK-tagged)-Human SH3-domain kinase binding protein 1 (SH3KBP1), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
SH3KBP1 (NM_031892) Human Tagged ORF Clone
RC202186

USD 480.00

In Stock

SH3KBP1 (Myc-DDK-tagged)-Human SH3-domain kinase binding protein 1 (SH3KBP1), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
SH3KBP1 (NM_031892) Human Tagged ORF Clone Lentiviral Particle
RC202186L1V

USD 880.00

3 Weeks

Lenti ORF particles, SH3KBP1 (Myc-DDK-tagged)-Human SH3-domain kinase binding protein 1 (SH3KBP1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
SH3KBP1 (NM_031892) Human Tagged ORF Clone Lentiviral Particle
RC202186L2V

USD 880.00

6 Weeks

Lenti ORF particles, SH3KBP1 (mGFP-tagged)-Human SH3-domain kinase binding protein 1 (SH3KBP1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
SH3KBP1 (NM_001024666) Human Tagged ORF Clone Lentiviral Particle
RC215701L1V

USD 820.00

3 Weeks

Lenti ORF particles, SH3KBP1 (Myc-DDK tagged) - Human SH3-domain kinase binding protein 1 (SH3KBP1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
SH3KBP1 (NM_001024666) Human Tagged ORF Clone Lentiviral Particle
RC215701L2V

USD 820.00

6 Weeks

Lenti ORF particles, SH3KBP1 (mGFP-tagged) - Human SH3-domain kinase binding protein 1 (SH3KBP1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
SH3KBP1 (NM_001184960) Human Tagged ORF Clone Lentiviral Particle
RC230063L1V

USD 820.00

3 Weeks

Lenti ORF particles, SH3KBP1 (Myc-DDK tagged) - Human SH3-domain kinase binding protein 1 (SH3KBP1), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
SH3KBP1 (NM_001184960) Human Tagged ORF Clone Lentiviral Particle
RC230063L2V

USD 820.00

6 Weeks

Lenti ORF particles, SH3KBP1 (mGFP-tagged) - Human SH3-domain kinase binding protein 1 (SH3KBP1), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
SH3KBP1 (NM_001184960) Human Tagged ORF Clone
RC230063

USD 420.00

In Stock

SH3KBP1 (Myc-DDK-tagged)-Human SH3-domain kinase binding protein 1 (SH3KBP1), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
SH3KBP1 (NM_031892) Human Tagged ORF Clone
RG202186

USD 530.00

In Stock

SH3KBP1 (GFP-tagged) - Human SH3-domain kinase binding protein 1 (SH3KBP1), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
SH3KBP1 (NM_031892) Human Tagged ORF Clone
RC202186L3

USD 680.00

3 Weeks

Lenti-ORF clone of SH3KBP1 (Myc-DDK-tagged)-Human SH3-domain kinase binding protein 1 (SH3KBP1), transcript variant 1

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
SH3KBP1 (NM_031892) Human Tagged ORF Clone Lentiviral Particle
RC202186L3V

USD 880.00

11 Weeks

Lenti ORF particles, SH3KBP1 (Myc-DDK-tagged)-Human SH3-domain kinase binding protein 1 (SH3KBP1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
SH3KBP1 (NM_031892) Human Tagged ORF Clone
RC202186L4

USD 680.00

3 Weeks

Lenti-ORF clone of SH3KBP1 (mGFP-tagged)-Human SH3-domain kinase binding protein 1 (SH3KBP1), transcript variant 1

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
SH3KBP1 (NM_031892) Human Tagged ORF Clone Lentiviral Particle
RC202186L4V

USD 880.00

11 Weeks

Lenti ORF particles, SH3KBP1 (mGFP-tagged)-Human SH3-domain kinase binding protein 1 (SH3KBP1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
SH3KBP1 (NM_001024666) Human Tagged ORF Clone
RC215701L3

USD 620.00

3 Weeks

Lenti ORF clone of Human SH3-domain kinase binding protein 1 (SH3KBP1), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
SH3KBP1 (NM_001024666) Human Tagged ORF Clone Lentiviral Particle
RC215701L3V

USD 820.00

7 Weeks

Lenti ORF particles, SH3KBP1 (Myc-DDK tagged) - Human SH3-domain kinase binding protein 1 (SH3KBP1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
SH3KBP1 (NM_001024666) Human Tagged ORF Clone
RC215701L4

USD 620.00

3 Weeks

Lenti ORF clone of Human SH3-domain kinase binding protein 1 (SH3KBP1), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
SH3KBP1 (NM_001024666) Human Tagged ORF Clone Lentiviral Particle
RC215701L4V

USD 820.00

7 Weeks

Lenti ORF particles, SH3KBP1 (mGFP-tagged) - Human SH3-domain kinase binding protein 1 (SH3KBP1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
SH3KBP1 (NM_001184960) Human Tagged ORF Clone
RC230063L3

USD 620.00

3 Weeks

Lenti ORF clone of Human SH3-domain kinase binding protein 1 (SH3KBP1), transcript variant 3, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
SH3KBP1 (NM_001184960) Human Tagged ORF Clone Lentiviral Particle
RC230063L3V

USD 820.00

7 Weeks

Lenti ORF particles, SH3KBP1 (Myc-DDK tagged) - Human SH3-domain kinase binding protein 1 (SH3KBP1), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
SH3KBP1 (NM_001184960) Human Tagged ORF Clone
RC230063L4

USD 620.00

3 Weeks

Lenti ORF clone of Human SH3-domain kinase binding protein 1 (SH3KBP1), transcript variant 3, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
SH3KBP1 (NM_001184960) Human Tagged ORF Clone Lentiviral Particle
RC230063L4V

USD 820.00

7 Weeks

Lenti ORF particles, SH3KBP1 (mGFP-tagged) - Human SH3-domain kinase binding protein 1 (SH3KBP1), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
SH3KBP1 (NM_001024666) Human Tagged ORF Clone
RG215701

USD 460.00

3 Weeks

SH3KBP1 (GFP-tagged) - Human SH3-domain kinase binding protein 1 (SH3KBP1), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
SH3KBP1 (NM_001184960) Human Tagged ORF Clone
RG230063

USD 460.00

3 Weeks

SH3KBP1 (GFP-tagged) - Human SH3-domain kinase binding protein 1 (SH3KBP1), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
SH3KBP1 (NM_031892) Human Untagged Clone
SC108004

USD 310.00

In Stock

SH3KBP1 (untagged)-Human SH3-domain kinase binding protein 1 (SH3KBP1), transcript variant 1

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
SH3KBP1 (NM_031892) Human Tagged Lenti ORF Clone
RC202186L1

USD 840.00

In Stock

Lenti-ORF clone of SH3KBP1 (Myc-DDK-tagged)-Human SH3-domain kinase binding protein 1 (SH3KBP1), transcript variant 1

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
SH3KBP1 (NM_001024666) Human Tagged Lenti ORF Clone
RC215701L1

USD 768.00

In Stock

Lenti ORF clone of Human SH3-domain kinase binding protein 1 (SH3KBP1), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
SH3KBP1 (NM_001184960) Human Tagged Lenti ORF Clone
RC230063L1

USD 768.00

In Stock

Lenti ORF clone of Human SH3-domain kinase binding protein 1 (SH3KBP1), transcript variant 3, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
SH3KBP1 (NM_031892) Human Over-expression Lysate
LY410454

USD 396.00

In Stock

Transient overexpression lysate of SH3-domain kinase binding protein 1 (SH3KBP1), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
SH3KBP1 (NM_031892) Human Tagged ORF Clone
RC202186L2

USD 680.00

3 Weeks

Lenti-ORF clone of SH3KBP1 (mGFP-tagged)-Human SH3-domain kinase binding protein 1 (SH3KBP1), transcript variant 1

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
SH3KBP1 (NM_001024666) Human Tagged ORF Clone
RC215701L2

USD 620.00

3 Weeks

Lenti ORF clone of Human SH3-domain kinase binding protein 1 (SH3KBP1), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
SH3KBP1 (NM_001184960) Human Tagged ORF Clone
RC230063L2

USD 620.00

3 Weeks

Lenti ORF clone of Human SH3-domain kinase binding protein 1 (SH3KBP1), transcript variant 3, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
SH3KBP1 (NM_031892) Human Untagged Clone
SC324001

USD 310.00

In Stock

SH3KBP1 (untagged)-Human SH3-domain kinase binding protein 1 (SH3KBP1), transcript variant 1

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
SH3KBP1 (2-14) Goat Polyclonal Antibody
AP23961PU-N

USD 440.00

2 Weeks

SH3KBP1 (2-14) goat polyclonal antibody, Aff - Purified

Applications IHC
Reactivities Bovine, Canine, Human, Monkey, Mouse, Rabbit, Rat
Immunogen Synthetic peptide from positions 2-14 of human SH3KBP1 (NP_114098.1)
SH3KBP1 Rabbit Polyclonal Antibody
TA334953

USD 375.00

5 Days

Rabbit Polyclonal Anti-SH3KBP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SH3KBP1 antibody: synthetic peptide directed towards the N terminal of human SH3KBP1. Synthetic peptide located within the following region: TGMFPSNFIKELSGESDELGISQDEQLSKSSLRETTGSESDGGDSSSTKS
SH3KBP1 (NM_031892) Human Over-expression Lysate
LC410454

USD 121.00

2 Weeks

SH3KBP1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
SH3KBP1 (NM_001024666) Human Over-expression Lysate
LC422529

USD 187.00

2 Weeks

SH3KBP1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
SH3KBP1 (NM_001024666) Human Over-expression Lysate
LC425458

USD 121.00

2 Weeks

SH3KBP1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
SH3KBP1 (NM_001024666) Human Over-expression Lysate
LY422529

USD 605.00

5 Days

Transient overexpression lysate of SH3-domain kinase binding protein 1 (SH3KBP1), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
LY422529 is the same product as LY425458.
SH3KBP1 (NM_001024666) Human Over-expression Lysate
LY425458

USD 396.00

5 Days

Transient overexpression lysate of SH3-domain kinase binding protein 1 (SH3KBP1), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
SH3KBP1 (NM_031892) Human Mass Spec Standard
PH302186

USD 2,055.00

3 Weeks

SH3KBP1 MS Standard C13 and N15-labeled recombinant protein (NP_114098)

Tag C-Myc/DDK
Expression Host HEK293
SH3KBP1 (NM_001024666) Human Mass Spec Standard
PH315701

USD 2,055.00

3 Weeks

SH3KBP1 MS Standard C13 and N15-labeled recombinant protein (NP_001019837)

Tag C-Myc/DDK
Expression Host HEK293
SH3KBP1 (NM_001024666) Human Untagged Clone
SC302281

USD 1,060.00

3 Weeks

SH3KBP1 (untagged)-Human SH3-domain kinase binding protein 1 (SH3KBP1), transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
SH3KBP1 (NM_001184960) Human Untagged Clone
SC328701

USD 720.00

3 Weeks

SH3KBP1 (untagged)-Human SH3-domain kinase binding protein 1 (SH3KBP1) transcript variant 3

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
SH3KBP1 Rabbit Polyclonal Antibody
TA350412

USD 345.00

In Stock

Rabbit Polyclonal Anti-SH3KBP1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human SH3KBP1
SH3KBP1 (NM_031892) ICC Control Block
TB402186

USD 1,130.00

4 Weeks

Transient overexpression of SH3KBP1 (NM_031892) in HEK293T cells paraffin embedded controls for ICC/IHC staining

SH3KBP1 (NM_001024666) ICC Control Block
TB415701

USD 1,420.00

4 Weeks

Transient overexpression of SH3KBP1 (NM_001024666) in HEK293T cells paraffin embedded controls for ICC/IHC staining

SH3KBP1 (NM_001184960) ICC Control Block
TB430063

USD 1,070.00

4 Weeks

Transient overexpression of SH3KBP1 (NM_001184960) in HEK293T cells paraffin embedded controls for ICC/IHC staining

SH3KBP1 Cytosection
TS402186

USD 225.00

4 Weeks

Transient overexpression of SH3KBP1 (NM_031892) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack