Products

cDNA Clones (14)
Proteins (7)
Antibodies (4)
Jump to Filters
View as table Download
Phospholipase D2 (PLD2) (NM_002663) Human Tagged ORF Clone
RG202042

USD 946.00

In Stock

PLD2 (GFP-tagged) - Human phospholipase D2 (PLD2)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Phospholipase D2 (PLD2) (NM_002663) Human Tagged ORF Clone
RC202042

USD 750.00

In Stock

PLD2 (Myc-DDK-tagged)-Human phospholipase D2 (PLD2)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Phospholipase D2 (PLD2) (NM_001243108) Human Tagged ORF Clone
RC235039

USD 750.00

5 Weeks

PLD2 (Myc-DDK tagged) - Homo sapiens phospholipase D2 (PLD2), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Phospholipase D2 (PLD2) (NM_001243108) Human Tagged ORF Clone
RG235039

USD 830.00

5 Weeks

PLD2 (GFP-tagged) - Homo sapiens phospholipase D2 (PLD2), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Phospholipase D2 (PLD2) (NM_002663) Human Untagged Clone
SC118498

USD 310.00

In Stock

PLD2 (untagged)-Human phospholipase D2 (PLD2)

Vector pCMV6-XL6
Tag Tag Free
Mammalian Cell Selection None
Phospholipase D2 (PLD2) (NM_002663) Human Untagged Clone
SC324003

USD 310.00

In Stock

PLD2 (untagged)-Human phospholipase D2 (PLD2)

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
Phospholipase D2 (PLD2) Rabbit Polyclonal Antibody
TA314349

USD 345.00

4 Weeks

Rabbit polyclonal PLD2 (Tyr169) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human PLD2 around the phosphorylation site of tyrosine 169 (E-N-YP-L-N).
Modifications Phospho-specific
Phospholipase D2 (PLD2) Rabbit Polyclonal Antibody
TA314350

USD 345.00

4 Weeks

Rabbit polyclonal PLD2 (Ab-169) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human PLD2.
Phospholipase D2 (PLD2) (NM_002663) Human Tagged ORF Clone
RC202042L2

USD 950.00

3 Weeks

Lenti-ORF clone of PLD2 (mGFP-tagged)-Human phospholipase D2 (PLD2)

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
Phospholipase D2 (PLD2) (NM_002663) Human Over-expression Lysate
LC419170

USD 121.00

In Stock

PLD2 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Phospholipase D2 (PLD2) Rabbit Polyclonal Antibody
TA335809

USD 375.00

5 Days

Rabbit Polyclonal Anti-PLD2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PLD2 Antibody: synthetic peptide directed towards the N terminal of human PLD2. Synthetic peptide located within the following region: MTATPESLFPTGDELDSSQLQMESDEVDTLKEGEDPADRMHPFLAIYELQ
Phospholipase D2 (PLD2) Rabbit Polyclonal Antibody
TA332122

USD 375.00

5 Days

Rabbit Polyclonal Anti-PLD2 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-PLD2 Antibody: synthetic peptide directed towards the middle region of human PLD2. Synthetic peptide located within the following region: DLHYRLTDLGDSSESAASQPPTPRPDSPATPDLSHNQFFWLGKDYSNLIT
Phospholipase D2 (PLD2) ICC Control Block
TB402042

USD 1,400.00

4 Weeks

Transient overexpression of PLD2 (NM_002663) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Phospholipase D2 (PLD2) ICC Control Block
TB435039

USD 1,400.00

4 Weeks

Transient overexpression of PLD2 (NM_001243108) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Phospholipase D2 (PLD2) Cytosection
TS402042

USD 225.00

4 Weeks

Transient overexpression of PLD2 (NM_002663) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Phospholipase D2 (PLD2) Cytosection
TS402042P5

USD 889.00

4 Weeks

Transient overexpression of PLD2 (NM_002663) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Phospholipase D2 (PLD2) ICC Control Sections
TS435039P5

USD 889.00

4 Weeks

Transient overexpression of PLD2 (NM_001243108) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack