Germany
Japan
United Kingdom
China
WASF1 (Myc-DDK-tagged)-Human WAS protein family, member 1 (WASF1), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
WASF1 (Myc-DDK-tagged)-Human WAS protein family, member 1 (WASF1), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
USD 820.00
3 Weeks
Lenti ORF particles, WASF1 (Myc-DDK tagged) - Human WAS protein family, member 1 (WASF1), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
USD 820.00
6 Weeks
Lenti ORF particles, WASF1 (mGFP-tagged) - Human WAS protein family, member 1 (WASF1), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
WASF1 (GFP-tagged) - Human WAS protein family, member 1 (WASF1), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
WASF1 (Myc-DDK-tagged)-Human WAS protein family, member 1 (WASF1), transcript variant 4
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
WASF1 (Myc-DDK-tagged)-Human WAS protein family, member 1 (WASF1), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti-ORF clone of WASF1 (Myc-DDK-tagged)-Human WAS protein family, member 1 (WASF1), transcript variant 2
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, WASF1 (Myc-DDK-tagged)-Human WAS protein family, member 1 (WASF1), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of WASF1 (mGFP-tagged)-Human WAS protein family, member 1 (WASF1), transcript variant 2
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, WASF1 (mGFP-tagged)-Human WAS protein family, member 1 (WASF1), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human WAS protein family, member 1 (WASF1), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
5 Weeks
Lenti ORF particles, WASF1 (Myc-DDK tagged) - Human WAS protein family, member 1 (WASF1), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human WAS protein family, member 1 (WASF1), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
7 Weeks
Lenti ORF particles, WASF1 (mGFP-tagged) - Human WAS protein family, member 1 (WASF1), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of WASF1 (Myc-DDK-tagged)-Human WAS protein family, member 1 (WASF1), transcript variant 4
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, WASF1 (Myc-DDK-tagged)-Human WAS protein family, member 1 (WASF1), transcript variant 4, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of WASF1 (mGFP-tagged)-Human WAS protein family, member 1 (WASF1), transcript variant 4
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, WASF1 (mGFP-tagged)-Human WAS protein family, member 1 (WASF1), transcript variant 4, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of WASF1 (Myc-DDK-tagged)-Human WAS protein family, member 1 (WASF1), transcript variant 3
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, WASF1 (Myc-DDK-tagged)-Human WAS protein family, member 1 (WASF1), transcript variant 3, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of WASF1 (mGFP-tagged)-Human WAS protein family, member 1 (WASF1), transcript variant 3
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, WASF1 (mGFP-tagged)-Human WAS protein family, member 1 (WASF1), transcript variant 3, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
WASF1 (GFP-tagged) - Human WAS protein family, member 1 (WASF1), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
WASF1 (GFP-tagged) - Human WAS protein family, member 1 (WASF1), transcript variant 4
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
WASF1 (GFP-tagged) - Human WAS protein family, member 1 (WASF1), transcript variant 3
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
WASF1 (untagged)-Human WAS protein family, member 1 (WASF1), transcript variant 1
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti ORF clone of Human WAS protein family, member 1 (WASF1), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit polyclonal WAVE1 (Tyr125) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human WAVE1 around the phosphorylation site of tyrosine 125 (E-T-YP-D-V). |
| Modifications | Phospho-specific |
Lenti ORF clone of Human WAS protein family, member 1 (WASF1), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit polyclonal WAVE1 (Ab-125) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human WAVE1 around the phosphorylation site of tyrosine 125 (E-T-YP-D-V). |
WASF1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
WASF1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Mouse monoclonal WAVE1/SCAR Antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Transient overexpression lysate of WAS protein family, member 1 (WASF1), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of WAS protein family, member 1 (WASF1), transcript variant 2
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
WASF1 (untagged)-Human WAS protein family, member 1 (WASF1), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
WASF1 (untagged)-Human WAS protein family, member 1 (WASF1), transcript variant 3
| Vector | pCMV6 series |
| Tag | Tag Free |
WASF1 (untagged)-Human WAS protein family, member 1 (WASF1), transcript variant 4
| Vector | pCMV6 series |
| Tag | Tag Free |
WASF1 Antibody
| Applications | IHC |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the following sequence TPYRDDGKEGLKFYTNPSYFFDLWKEKMLQDTEDKRKEKRKQKQKNLDRP |
Transient overexpression of WASF1 (NM_001024934) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of WASF1 (NM_003931) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of WASF1 (NM_001024936) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of WASF1 (NM_001024935) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of WASF1 (NM_001024934) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of WASF1 (NM_001024934) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of WASF1 (NM_003931) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of WASF1 (NM_003931) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of WASF1 (NM_001024936) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of WASF1 (NM_001024936) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- WASF1
Pathways
- Fc gamma R-mediated phagocytosis