Germany
Japan
United Kingdom
China
PDGFA (Myc-DDK-tagged)-Human platelet-derived growth factor alpha polypeptide (PDGFA), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
PDGFA (Myc-DDK-tagged)-Human platelet-derived growth factor alpha polypeptide (PDGFA), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
USD 820.00
3 Weeks
Lenti ORF particles, PDGFA (Myc-DDK tagged) - Human platelet-derived growth factor alpha polypeptide (PDGFA), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
USD 820.00
6 Weeks
Lenti ORF particles, PDGFA (mGFP-tagged) - Human platelet-derived growth factor alpha polypeptide (PDGFA), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
USD 820.00
3 Weeks
Lenti ORF particles, PDGFA (Myc-DDK tagged) - Human platelet-derived growth factor alpha polypeptide (PDGFA), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
USD 820.00
6 Weeks
Lenti ORF particles, PDGFA (mGFP-tagged) - Human platelet-derived growth factor alpha polypeptide (PDGFA), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
USD 820.00
5 Weeks
Lenti ORF particles, PDGFA (Myc-DDK tagged) - Human platelet-derived growth factor alpha polypeptide (PDGFA), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human platelet-derived growth factor alpha polypeptide (PDGFA), transcript variant 2, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
3 Weeks
Lenti ORF particles, PDGFA (mGFP-tagged) - Human platelet-derived growth factor alpha polypeptide (PDGFA), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human platelet-derived growth factor alpha polypeptide (PDGFA), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
5 Weeks
Lenti ORF particles, PDGFA (Myc-DDK tagged) - Human platelet-derived growth factor alpha polypeptide (PDGFA), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human platelet-derived growth factor alpha polypeptide (PDGFA), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
3 Weeks
Lenti ORF particles, PDGFA (mGFP-tagged) - Human platelet-derived growth factor alpha polypeptide (PDGFA), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
PDGFA (GFP-tagged) - Human platelet-derived growth factor alpha polypeptide (PDGFA), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PDGFA (GFP-tagged) - Human platelet-derived growth factor alpha polypeptide (PDGFA), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PDGFA (untagged)-Human platelet-derived growth factor alpha polypeptide (PDGFA), transcript variant 1
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Purified recombinant protein of Human platelet-derived growth factor alpha polypeptide (PDGFA), transcript variant 1.
| Tag | Tag Free |
| Expression Host | E. coli |
Transient overexpression lysate of platelet-derived growth factor alpha polypeptide (PDGFA), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
PDGF AA (PDGFA) (PDGF-AA) rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, FN, IHC, WB |
| Reactivities | Human |
| Immunogen | Highly pure (>98%) E.coli derived recombinant Human PDGF-AA (Cat.-No PA118). |
PDGFA (PDGF-AA) human recombinant protein, 5 µg
| Expression Host | E. coli |
PDGFA (PDGF-AA) human recombinant protein, 2 µg
| Expression Host | E. coli |
PDGFA (PDGF-AA) human recombinant protein, 20 µg
| Expression Host | E. coli |
PDGFA (PDGF-AB) human recombinant protein, 5 µg
| Expression Host | E. coli |
PDGFA (PDGF-AB) human recombinant protein, 2 µg
| Expression Host | E. coli |
PDGFA (PDGF-AB) human recombinant protein, 20 µg
| Expression Host | E. coli |
Rabbit Polyclonal Anti-PDGFA Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PDGFA Antibody: A synthesized peptide |
Lenti ORF clone of Human platelet-derived growth factor alpha polypeptide (PDGFA), transcript variant 2, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human platelet-derived growth factor alpha polypeptide (PDGFA), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Purified recombinant protein of Human platelet-derived growth factor alpha polypeptide (PDGFA), transcript variant 2
| Tag | N-His |
| Expression Host | E. coli |
Rabbit Polyclonal Anti-PDGFA Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PDGFA antibody is: synthetic peptide directed towards the C-terminal region of Human PDGFA. Synthetic peptide located within the following region: HRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATTSLNPDYREEDTDVR |
PDGFA HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
PDGFA HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
PDGFA HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of platelet-derived growth factor alpha polypeptide (PDGFA), transcript variant 2
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
LY409784 is the same product as LY429844.
Transient overexpression lysate of platelet-derived growth factor alpha polypeptide (PDGFA), transcript variant 2
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
PDGFA MS Standard C13 and N15-labeled recombinant protein (NP_148983)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
PDGFA (untagged)-Human platelet-derived growth factor alpha polypeptide (PDGFA), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Anti-PDGFA Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 101-114 amino acids of Human platelet-derived growth factor alpha polypeptide |
Transient overexpression of PDGFA (NM_033023) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PDGFA (NM_002607) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Purified recombinant protein of Human platelet-derived growth factor alpha polypeptide (PDGFA), transcript variant 2
| Tag | N-His |
| Expression Host | E. coli |
Purified recombinant protein of Human platelet-derived growth factor alpha polypeptide (PDGFA), transcript variant 2
| Tag | N-His |
| Expression Host | E. coli |
Purified recombinant protein of Human platelet-derived growth factor alpha polypeptide (PDGFA), transcript variant 2
| Tag | N-His |
| Expression Host | E. coli |
Active filters
Target Symbol
- PDGFA
Pathways
- Focal adhesion