PDGFA (Myc-DDK-tagged)-Human platelet-derived growth factor alpha polypeptide (PDGFA), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PDGFA (Myc-DDK-tagged)-Human platelet-derived growth factor alpha polypeptide (PDGFA), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PDGFA (Myc-DDK-tagged)-Human platelet-derived growth factor alpha polypeptide (PDGFA), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
USD 820.00
3 Weeks
Lenti ORF particles, PDGFA (Myc-DDK tagged) - Human platelet-derived growth factor alpha polypeptide (PDGFA), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 820.00
6 Weeks
Lenti ORF particles, PDGFA (mGFP-tagged) - Human platelet-derived growth factor alpha polypeptide (PDGFA), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
USD 820.00
3 Weeks
Lenti ORF particles, PDGFA (Myc-DDK tagged) - Human platelet-derived growth factor alpha polypeptide (PDGFA), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 820.00
6 Weeks
Lenti ORF particles, PDGFA (mGFP-tagged) - Human platelet-derived growth factor alpha polypeptide (PDGFA), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
USD 820.00
5 Weeks
Lenti ORF particles, PDGFA (Myc-DDK tagged) - Human platelet-derived growth factor alpha polypeptide (PDGFA), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human platelet-derived growth factor alpha polypeptide (PDGFA), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
3 Weeks
Lenti ORF particles, PDGFA (mGFP-tagged) - Human platelet-derived growth factor alpha polypeptide (PDGFA), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human platelet-derived growth factor alpha polypeptide (PDGFA), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
5 Weeks
Lenti ORF particles, PDGFA (Myc-DDK tagged) - Human platelet-derived growth factor alpha polypeptide (PDGFA), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human platelet-derived growth factor alpha polypeptide (PDGFA), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
3 Weeks
Lenti ORF particles, PDGFA (mGFP-tagged) - Human platelet-derived growth factor alpha polypeptide (PDGFA), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
PDGFA (GFP-tagged) - Human platelet-derived growth factor alpha polypeptide (PDGFA), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
PDGFA (GFP-tagged) - Human platelet-derived growth factor alpha polypeptide (PDGFA), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
PDGFA (untagged)-Human platelet-derived growth factor alpha polypeptide (PDGFA), transcript variant 1
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Purified recombinant protein of Human platelet-derived growth factor alpha polypeptide (PDGFA), transcript variant 1.
Tag | Tag Free |
Expression Host | E. coli |
Transient overexpression lysate of platelet-derived growth factor alpha polypeptide (PDGFA), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
PDGF AA (PDGFA) (PDGF-AA) rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, FN, IHC, WB |
Reactivities | Human |
Immunogen | Highly pure (>98%) E.coli derived recombinant Human PDGF-AA (Cat.-No PA118). |
PDGF AA (PDGFA) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide, corresponding to amino acids 121-160 of Human PDGF-A. |
PDGFA (PDGF-AA) human recombinant protein, 5 µg
Expression Host | E. coli |
PDGFA (PDGF-AA) human recombinant protein, 2 µg
Expression Host | E. coli |
PDGFA (PDGF-AA) human recombinant protein, 20 µg
Expression Host | E. coli |
PDGFA (PDGF-AB) human recombinant protein, 5 µg
Expression Host | E. coli |
PDGFA (PDGF-AB) human recombinant protein, 2 µg
Expression Host | E. coli |
PDGFA (PDGF-AB) human recombinant protein, 20 µg
Expression Host | E. coli |
PDGF AA (PDGFA) (PDGF-AA) rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, FN, IHC, WB |
Reactivities | Human |
Immunogen | Highly pure (>98%) recombinant hPDGF-AA |
Rabbit Polyclonal Anti-PDGFA Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PDGFA Antibody: A synthesized peptide |
PDGF AA (PDGFA) (PDGF-AA) rabbit polyclonal antibody, Biotin
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Biotin |
Immunogen | Highly pure (>98%) E.coli derived recombinant Human PDGF-AA (Cat.-No PA118) |
Lenti ORF clone of Human platelet-derived growth factor alpha polypeptide (PDGFA), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Lenti ORF clone of Human platelet-derived growth factor alpha polypeptide (PDGFA), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
PDGF AA (PDGFA) (PDGF-AA) rabbit polyclonal antibody, Biotin
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Biotin |
Immunogen | Highly pure (>98%) E.coli derived recombinant Human PDGF-AA (Cat.-No PA118) |
Anti-Human PDGF-AA Rabbit Polyclonal Antibody
Applications | ELISA, IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human PDGF-AA |
Purified recombinant protein of Human platelet-derived growth factor alpha polypeptide (PDGFA), transcript variant 2
Tag | N-His |
Expression Host | E. coli |
Biotinylated Anti-Human PDGF-AA Rabbit Polyclonal Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human PDGF-AA |
Rabbit Polyclonal Anti-PDGFA Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PDGFA antibody is: synthetic peptide directed towards the C-terminal region of Human PDGFA. Synthetic peptide located within the following region: HRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATTSLNPDYREEDTDVR |
PDGFA HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
PDGFA HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
PDGFA HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of platelet-derived growth factor alpha polypeptide (PDGFA), transcript variant 2
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Transient overexpression lysate of platelet-derived growth factor alpha polypeptide (PDGFA), transcript variant 2
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
PDGFA MS Standard C13 and N15-labeled recombinant protein (NP_148983)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
PDGFA (untagged)-Human platelet-derived growth factor alpha polypeptide (PDGFA), transcript variant 2
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Anti-PDGFA Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 101-114 amino acids of Human platelet-derived growth factor alpha polypeptide |
Anti-PDGFA Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 101-114 amino acids of Human platelet-derived growth factor alpha polypeptide |
Transient overexpression of PDGFA (NM_033023) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PDGFA (NM_002607) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Purified recombinant protein of Human platelet-derived growth factor alpha polypeptide (PDGFA), transcript variant 2
Tag | N-His |
Expression Host | E. coli |
Purified recombinant protein of Human platelet-derived growth factor alpha polypeptide (PDGFA), transcript variant 2
Tag | N-His |
Expression Host | E. coli |
Purified recombinant protein of Human platelet-derived growth factor alpha polypeptide (PDGFA), transcript variant 2
Tag | N-His |
Expression Host | E. coli |