Products

View as table Download

Purified recombinant protein of Homo sapiens alanyl (membrane) aminopeptidase (ANPEP)

Tag C-Myc/DDK
Expression Host HEK293T

ANPEP (Myc-DDK-tagged)-Human alanyl (membrane) aminopeptidase (ANPEP)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

ANPEP (GFP-tagged) - Human alanyl (membrane) aminopeptidase (ANPEP)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti-ORF clone of ANPEP (mGFP-tagged)-Human alanyl (membrane) aminopeptidase (ANPEP)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Rabbit monoclonal antibody against CD13(clone EPR4058)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ANPEP (untagged)-Human alanyl (membrane) aminopeptidase (ANPEP)

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
SC119422 is the updated version of SC125423.

CD13 (ANPEP) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen Synthetic peptide, corresponding to amino acids 880-930 of Human CD13.

Rabbit anti-ANPEP Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ANPEP

CD13 (ANPEP) mouse monoclonal antibody, clone B-F10, PE

Applications FC
Reactivities Human
Conjugation PE

CD13 (ANPEP) mouse monoclonal antibody, clone WM15, Biotin

Applications FC
Reactivities Human, Primate
Conjugation Biotin

Rabbit Polyclonal Anti-ANPEP Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ANPEP antibody: synthetic peptide directed towards the N terminal of human ANPEP. Synthetic peptide located within the following region: VGGSQPPDIDKTELVEPTEYLVVHLKGSLVKDSQYEMDSEFEGELADDLA

CD13 (ANPEP) mouse monoclonal antibody, clone B-F10, Azide Free

Applications FC
Reactivities Human

CD13 (ANPEP) mouse monoclonal antibody, clone B-F10, FITC

Applications FC
Reactivities Human
Conjugation FITC

CD13 (ANPEP) mouse monoclonal antibody, clone B-F10, Purified

Applications FC
Reactivities Human

CD13 (ANPEP) mouse monoclonal antibody, clone WM15, APC

Applications FC
Reactivities Human, Primate
Conjugation APC

CD13 (ANPEP) mouse monoclonal antibody, clone WM15, FITC

Applications FC
Reactivities Human, Primate
Conjugation FITC

CD13 (ANPEP) mouse monoclonal antibody, clone WM15, PE

Applications FC
Reactivities Human, Primate
Conjugation PE

Mouse Anti-Human CD13 Purified (100 ug)

Applications FC
Reactivities Human
Conjugation Unconjugated

Goat Anti-CD13 / ANPEP (aa79-91) Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-TLKPDSYRVTLRP, from the internal region (near N terminus) of the protein sequence according to NP_001141.2

Goat Anti-CD13 / ANPEP Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-QLEQFKKDNEET, from the internal region (near C terminus) of the protein sequence according to NP_001141.2

Carrier-free (BSA/glycerol-free) ANPEP mouse monoclonal antibody, clone OTI2E4 (formerly 2E4)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ANPEP mouse monoclonal antibody, clone OTI2F10 (formerly 2F10)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ANPEP mouse monoclonal antibody, clone OTI3F8 (formerly 3F8)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

ANPEP MS Standard C13 and N15-labeled recombinant protein (NP_001141)

Tag C-Myc/DDK
Expression Host HEK293

Rabbit Polyclonal Anti-ANPEP Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human ANPEP

ANPEP mouse monoclonal antibody, clone OTI2E4 (formerly 2E4)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

ANPEP mouse monoclonal antibody, clone OTI2E4 (formerly 2E4), Biotinylated

Applications IHC, WB
Reactivities Human
Conjugation Biotin

ANPEP mouse monoclonal antibody, clone OTI2E4 (formerly 2E4), HRP conjugated

Applications IHC, WB
Reactivities Human
Conjugation HRP

ANPEP mouse monoclonal antibody, clone OTI2E4 (formerly 2E4)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

ANPEP mouse monoclonal antibody, clone OTI2F10 (formerly 2F10)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

ANPEP mouse monoclonal antibody, clone OTI2F10 (formerly 2F10), Biotinylated

Applications IHC, WB
Reactivities Human
Conjugation Biotin

ANPEP mouse monoclonal antibody, clone OTI2F10 (formerly 2F10), HRP conjugated

Applications IHC, WB
Reactivities Human
Conjugation HRP

ANPEP mouse monoclonal antibody, clone OTI2F10 (formerly 2F10)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

ANPEP mouse monoclonal antibody, clone OTI3F8 (formerly 3F8)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

ANPEP mouse monoclonal antibody, clone OTI3F8 (formerly 3F8), Biotinylated

Applications IHC, WB
Reactivities Human
Conjugation Biotin

ANPEP mouse monoclonal antibody, clone OTI3F8 (formerly 3F8), HRP conjugated

Applications IHC, WB
Reactivities Human
Conjugation HRP

ANPEP mouse monoclonal antibody, clone OTI3F8 (formerly 3F8)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Transient overexpression of ANPEP (NM_001150) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 225.00

4 Weeks

Transient overexpression of ANPEP (NM_001150) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Transient overexpression of ANPEP (NM_001150) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Carrier-free (BSA/glycerol-free) CD13 mouse monoclonal antibody,clone UMAB275

Applications IHC
Reactivities Human
Conjugation Unconjugated