Products

cDNA Clones (26)
Proteins (11)
Antibodies (9)
Jump to Filters
View as table Download
CBS (NM_000071) Human Tagged ORF Clone
RC201755

USD 420.00

In Stock

CBS (Myc-DDK-tagged)-Human cystathionine-beta-synthase (CBS), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
CBS (NM_000071) Human Tagged ORF Clone Lentiviral Particle
RC201755L4V

USD 1,020.00

3 Weeks

Lenti ORF particles, CBS (mGFP-tagged) - Human cystathionine-beta-synthase (CBS), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CBS (NM_000071) Human Tagged ORF Clone Lentiviral Particle
RC201755L1V

USD 820.00

3 Weeks

Lenti ORF particles, CBS (Myc-DDK tagged) - Human cystathionine-beta-synthase (CBS), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
CBS (NM_000071) Human Tagged ORF Clone Lentiviral Particle
RC201755L2V

USD 820.00

6 Weeks

Lenti ORF particles, CBS (mGFP-tagged) - Human cystathionine-beta-synthase (CBS), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
CBS (NM_000071) Human Tagged ORF Clone
RG201755

USD 460.00

In Stock

CBS (GFP-tagged) - Human cystathionine-beta-synthase (CBS), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CBS (NM_001178009) Human Tagged ORF Clone
RG230261

USD 460.00

In Stock

CBS (GFP-tagged) - Human cystathionine-beta-synthase (CBS), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CBS (NM_000071) Human Tagged ORF Clone Lentiviral Particle
RC201755L3V

USD 820.00

5 Weeks

Lenti ORF particles, CBS (Myc-DDK tagged) - Human cystathionine-beta-synthase (CBS), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CBS (NM_001178008) Human Tagged ORF Clone
RC230260

USD 420.00

4 Weeks

CBS (Myc-DDK-tagged)-Human cystathionine-beta-synthase (CBS), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
CBS (NM_001178008) Human Tagged ORF Clone
RC230260L3

USD 620.00

4 Weeks

Lenti-ORF clone of CBS (Myc-DDK-tagged)-Human cystathionine-beta-synthase (CBS), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CBS (NM_001178008) Human Tagged ORF Clone Lentiviral Particle
RC230260L3V

USD 820.00

7 Weeks

Lenti ORF particles, CBS (Myc-DDK-tagged)-Human cystathionine-beta-synthase (CBS), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CBS (NM_001178008) Human Tagged ORF Clone
RC230260L4

USD 620.00

4 Weeks

Lenti-ORF clone of CBS (mGFP-tagged)-Human cystathionine-beta-synthase (CBS), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CBS (NM_001178008) Human Tagged ORF Clone Lentiviral Particle
RC230260L4V

USD 820.00

7 Weeks

Lenti ORF particles, CBS (mGFP-tagged)-Human cystathionine-beta-synthase (CBS), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CBS (NM_001178009) Human Tagged ORF Clone
RC230261

USD 420.00

3 Weeks

CBS (Myc-DDK-tagged)-Human cystathionine-beta-synthase (CBS), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
CBS (NM_001178009) Human Tagged ORF Clone
RC230261L3

USD 620.00

3 Weeks

Lenti-ORF clone of CBS (Myc-DDK-tagged)-Human cystathionine-beta-synthase (CBS), transcript variant 3

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CBS (NM_001178009) Human Tagged ORF Clone Lentiviral Particle
RC230261L3V

USD 820.00

6 Weeks

Lenti ORF particles, CBS (Myc-DDK-tagged)-Human cystathionine-beta-synthase (CBS), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CBS (NM_001178009) Human Tagged ORF Clone
RC230261L4

USD 620.00

3 Weeks

Lenti-ORF clone of CBS (mGFP-tagged)-Human cystathionine-beta-synthase (CBS), transcript variant 3

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CBS (NM_001178009) Human Tagged ORF Clone Lentiviral Particle
RC230261L4V

USD 820.00

6 Weeks

Lenti ORF particles, CBS (mGFP-tagged)-Human cystathionine-beta-synthase (CBS), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CBS (NM_001178008) Human Tagged ORF Clone
RG230260

USD 460.00

4 Weeks

CBS (GFP-tagged) - Human cystathionine-beta-synthase (CBS), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CBS (NM_000071) Human Tagged Lenti ORF Clone
RC201755L4

USD 768.00

In Stock

Lenti ORF clone of Human cystathionine-beta-synthase (CBS), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CBS Rabbit Polyclonal Antibody
TA308071

USD 415.00

In Stock

Rabbit Polyclonal antibody to CBS (cystathionine-beta-synthase)

Applications IF, IHC, IP, WB
Reactivities Human
Immunogen Recombinant fragment corresponding to a region within amino acids 39 and 251 of CBS (Uniprot ID#P35520)
CBS (NM_000071) Human Tagged ORF Clone
RC201755L1

USD 768.00

In Stock

Lenti ORF clone of Human cystathionine-beta-synthase (CBS), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
CBS Rabbit Polyclonal Antibody
TA327044

USD 275.00

3 Weeks

Rabbit anti-CBS Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CBS
CBS Rabbit Polyclonal Antibody
TA338394

USD 310.00

5 Days

Rabbit Polyclonal Anti-CBS Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen The immunogen for anti-CBS antibody: synthetic peptide directed towards the N terminal of human CBS. Synthetic peptide located within the following region: RCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNE
CBS (NM_000071) Human Untagged Clone
SC324364

USD 760.00

In Stock

CBS (untagged)-Human cystathionine-beta-synthase (CBS), transcript variant 1

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
CBS (NM_000071) Human Over-expression Lysate
LY400017

USD 396.00

In Stock

Transient overexpression lysate of cystathionine-beta-synthase (CBS)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CBSL Mouse Monoclonal Antibody [Clone ID: 3E1]
AM31730PU-N

USD 480.00

2 Weeks

CBSL mouse monoclonal antibody, clone 3E1, Purified

Applications ELISA, IHC, IP, WB
Reactivities Human, Rat
CBSL Mouse Monoclonal Antibody [Clone ID: 6B8]
AM31731PU-N

USD 480.00

2 Weeks

CBSL mouse monoclonal antibody, clone 6B8, Purified

Applications ELISA, IHC, WB
Reactivities Human
CBSL Mouse Monoclonal Antibody [Clone ID: 6A9]
AM31732PU-N

USD 480.00

2 Weeks

CBSL mouse monoclonal antibody, clone 6A9, Purified

Applications ELISA, IHC, WB
Reactivities Human
CBSL Mouse Monoclonal Antibody [Clone ID: 5F7]
AM31733PU-N

USD 480.00

2 Weeks

CBSL mouse monoclonal antibody, clone 5F7, Purified

Applications ELISA, IHC, WB
Reactivities Human
CBS (NM_000071) Human Over-expression Lysate
LC400017

USD 121.00

In Stock

CBS HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
CBS (NM_000071) Human Tagged ORF Clone
RC201755L2

USD 620.00

3 Weeks

Lenti ORF clone of Human cystathionine-beta-synthase (CBS), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
CBS (NM_000071) Human Untagged Clone
SC128074

USD 760.00

2 Weeks

CBS (untagged)-Human cystathionine-beta-synthase (CBS), transcript variant 1

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
CBSL Rabbit Polyclonal Antibody
AP17189PU-N

USD 450.00

2 Weeks

CBSL rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide selected from the Center region of human CBS
CBS (NM_000071) Human Mass Spec Standard
PH301755

USD 2,055.00

3 Weeks

CBS MS Standard C13 and N15-labeled recombinant protein (NP_000062)

Tag C-Myc/DDK
Expression Host HEK293
CBS (NM_001178008) Human Untagged Clone
SC328898

USD 760.00

4 Weeks

CBS (untagged)-Human cystathionine-beta-synthase (CBS) transcript variant 2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
CBS (NM_001178009) Human Untagged Clone
SC328899

USD 760.00

4 Weeks

CBS (untagged)-Human cystathionine-beta-synthase (CBS) transcript variant 3

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
CBS Rabbit Polyclonal Antibody
TA349577

USD 345.00

In Stock

Rabbit Polyclonal Anti-CBS Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human CBS
CBS ICC Control Block
TB401755

USD 1,070.00

4 Weeks

Transient overexpression of CBS (NM_000071) in HEK293T cells paraffin embedded controls for ICC/IHC staining

CBS ICC Control Block
TB430260

USD 1,070.00

4 Weeks

Transient overexpression of CBS (NM_001178008) in HEK293T cells paraffin embedded controls for ICC/IHC staining

CBS ICC Control Block
TB430261

USD 1,070.00

4 Weeks

Transient overexpression of CBS (NM_001178009) in HEK293T cells paraffin embedded controls for ICC/IHC staining

CBS Cytosection
TS401755

USD 225.00

4 Weeks

Transient overexpression of CBS (NM_000071) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

CBS Cytosection
TS401755P5

USD 889.00

4 Weeks

Transient overexpression of CBS (NM_000071) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

CBS ICC Control Sections
TS430260P5

USD 889.00

4 Weeks

Transient overexpression of CBS (NM_001178008) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

CBS ICC Control Sections
TS430261P5

USD 889.00

4 Weeks

Transient overexpression of CBS (NM_001178009) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack