CBS (Myc-DDK-tagged)-Human cystathionine-beta-synthase (CBS), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CBS (Myc-DDK-tagged)-Human cystathionine-beta-synthase (CBS), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, CBS (mGFP-tagged) - Human cystathionine-beta-synthase (CBS), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Recombinant protein of human cystathionine-beta-synthase (CBS)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Lenti ORF particles, CBS (Myc-DDK tagged) - Human cystathionine-beta-synthase (CBS), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, CBS (mGFP-tagged) - Human cystathionine-beta-synthase (CBS), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
CBS (GFP-tagged) - Human cystathionine-beta-synthase (CBS), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
CBS (GFP-tagged) - Human cystathionine-beta-synthase (CBS), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, CBS (Myc-DDK tagged) - Human cystathionine-beta-synthase (CBS), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
CBS (Myc-DDK-tagged)-Human cystathionine-beta-synthase (CBS), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of CBS (Myc-DDK-tagged)-Human cystathionine-beta-synthase (CBS), transcript variant 2
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CBS (Myc-DDK-tagged)-Human cystathionine-beta-synthase (CBS), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of CBS (mGFP-tagged)-Human cystathionine-beta-synthase (CBS), transcript variant 2
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CBS (mGFP-tagged)-Human cystathionine-beta-synthase (CBS), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
CBS (Myc-DDK-tagged)-Human cystathionine-beta-synthase (CBS), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of CBS (Myc-DDK-tagged)-Human cystathionine-beta-synthase (CBS), transcript variant 3
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CBS (Myc-DDK-tagged)-Human cystathionine-beta-synthase (CBS), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of CBS (mGFP-tagged)-Human cystathionine-beta-synthase (CBS), transcript variant 3
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CBS (mGFP-tagged)-Human cystathionine-beta-synthase (CBS), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
CBS (GFP-tagged) - Human cystathionine-beta-synthase (CBS), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human cystathionine-beta-synthase (CBS), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Rabbit Polyclonal antibody to CBS (cystathionine-beta-synthase)
Applications | IF, IHC, IP, WB |
Reactivities | Human |
Immunogen | Recombinant fragment corresponding to a region within amino acids 39 and 251 of CBS (Uniprot ID#P35520) |
Lenti ORF clone of Human cystathionine-beta-synthase (CBS), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human cystathionine-beta-synthase (CBS), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Rabbit anti-CBS Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CBS |
Rabbit Polyclonal Anti-CBS Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | The immunogen for anti-CBS antibody: synthetic peptide directed towards the N terminal of human CBS. Synthetic peptide located within the following region: RCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNE |
CBS (untagged)-Human cystathionine-beta-synthase (CBS), transcript variant 1
Vector | pCMV6-AC |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Transient overexpression lysate of cystathionine-beta-synthase (CBS)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
CBSL mouse monoclonal antibody, clone 3E1, Purified
Applications | ELISA, IHC, IP, WB |
Reactivities | Human, Rat |
CBSL mouse monoclonal antibody, clone 6B8, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
CBSL mouse monoclonal antibody, clone 6A9, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
CBSL mouse monoclonal antibody, clone 5F7, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
CBS HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Lenti ORF clone of Human cystathionine-beta-synthase (CBS), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
CBS (untagged)-Human cystathionine-beta-synthase (CBS), transcript variant 1
Vector | pCMV6-AC |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
CBSL rabbit polyclonal antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide selected from the Center region of human CBS |
CBS MS Standard C13 and N15-labeled recombinant protein (NP_000062)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
CBS (untagged)-Human cystathionine-beta-synthase (CBS) transcript variant 2
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
CBS (untagged)-Human cystathionine-beta-synthase (CBS) transcript variant 3
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-CBS Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CBS |
Transient overexpression of CBS (NM_000071) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CBS (NM_001178008) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CBS (NM_001178009) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CBS (NM_000071) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CBS (NM_000071) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of CBS (NM_001178008) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of CBS (NM_001178009) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack