Products

View as table Download

ENO3 (Myc-DDK-tagged)-Human enolase 3 (beta, muscle) (ENO3), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

ENO3 (Myc-DDK-tagged)-Human enolase 3 (beta, muscle) (ENO3), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

ENO3 (Myc-DDK-tagged)-Human enolase 3 (beta, muscle) (ENO3), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Recombinant protein of human enolase 3 (beta, muscle) (ENO3), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T

Lenti ORF particles, ENO3 (Myc-DDK tagged) - Human enolase 3 (beta, muscle) (ENO3), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®

Lenti ORF particles, ENO3 (mGFP-tagged) - Human enolase 3 (beta, muscle) (ENO3), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®

ENO3 (GFP-tagged) - Human enolase 3 (beta, muscle) (ENO3), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human enolase 3 (beta, muscle) (ENO3), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, ENO3 (Myc-DDK tagged) - Human enolase 3 (beta, muscle) (ENO3), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human enolase 3 (beta, muscle) (ENO3), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, ENO3 (mGFP-tagged) - Human enolase 3 (beta, muscle) (ENO3), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human enolase 3 (beta, muscle) (ENO3), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, ENO3 (Myc-DDK tagged) - Human enolase 3 (beta, muscle) (ENO3), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human enolase 3 (beta, muscle) (ENO3), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, ENO3 (mGFP-tagged) - Human enolase 3 (beta, muscle) (ENO3), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human enolase 3 (beta, muscle) (ENO3), transcript variant 3, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, ENO3 (Myc-DDK tagged) - Human enolase 3 (beta, muscle) (ENO3), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human enolase 3 (beta, muscle) (ENO3), transcript variant 3, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, ENO3 (mGFP-tagged) - Human enolase 3 (beta, muscle) (ENO3), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

ENO3 (GFP-tagged) - Human enolase 3 (beta, muscle) (ENO3), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

ENO3 (GFP-tagged) - Human enolase 3 (beta, muscle) (ENO3), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

ENO3 (untagged)-Human enolase 3 (beta, muscle) (ENO3), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

Rabbit Polyclonal Anti-ENO3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ENO3 antibody: synthetic peptide directed towards the N terminal of human ENO3. Synthetic peptide located within the following region: EVDLHTAKGRFRAAVPSGASTGIYEALELRDGDKGRYLGKGVLKAVENIN

Rabbit Polyclonal Anti-ENO3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ENO3 antibody: synthetic peptide directed towards the N terminal of human ENO3. Synthetic peptide located within the following region: MAMQKIFAREILDSRGNPTVEVDLHTAKGRFRAAVPSGASTGIYEALELR

Enolase beta (1-434, His-tag) human recombinant protein, 0.25 mg

Tag His-tag
Expression Host E. coli

Enolase beta (1-434, His-tag) human recombinant protein, 50 µg

Tag His-tag
Expression Host E. coli

Lenti ORF clone of Human enolase 3 (beta, muscle) (ENO3), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

ENO3 mouse monoclonal antibody, clone 5D1, Purified

Applications ELISA, IF, IHC, WB
Reactivities Human

Rabbit Polyclonal Anti-b-Enolase(ENO-3) Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-b-Enolase(ENO-3) Antibody: Peptide sequence around aa.49~53(L-R-D-G-D) derived from Human b-Enolase(ENO-3).

Lenti ORF clone of Human enolase 3 (beta, muscle) (ENO3), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

ENO3 (untagged)-Human enolase 3 (beta, muscle) (ENO3), transcript variant 2

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin

ENO3 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

ENO3 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Rabbit Polyclonal antibody to ENO3 (enolase 3 (beta, muscle))

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 196 and 434 of ENO3 (Uniprot ID#P13929)

Anti-ENO3 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide sequence around aa.49~53(L-R-D-G-D) derived from Human β-Enolase(ENO-3).

ENO3 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

ENO3 MS Standard C13 and N15-labeled recombinant protein (NP_443739)

Tag C-Myc/DDK
Expression Host HEK293

ENO3 MS Standard C13 and N15-labeled recombinant protein (NP_001967)

Tag C-Myc/DDK
Expression Host HEK293

USD 1,070.00

4 Weeks

Transient overexpression of ENO3 (NM_053013) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 1,070.00

4 Weeks

Transient overexpression of ENO3 (NM_001976) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 1,070.00

4 Weeks

Transient overexpression of ENO3 (NM_001193503) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 225.00

4 Weeks

Transient overexpression of ENO3 (NM_053013) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of ENO3 (NM_053013) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

USD 225.00

4 Weeks

Transient overexpression of ENO3 (NM_001976) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of ENO3 (NM_001976) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

USD 225.00

4 Weeks

Transient overexpression of ENO3 (NM_001193503) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of ENO3 (NM_001193503) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack