Products

Antibodies (44)
cDNA Clones (19)
Proteins (12)
Jump to Filters
View as table Download
Pyruvate Kinase (PKLR) (NM_000298) Human Tagged ORF Clone
RC206455

USD 420.00

In Stock

PKLR (Myc-DDK-tagged)-Human pyruvate kinase, liver and RBC (PKLR), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Pyruvate Kinase (PKLR) (NM_000298) Human Recombinant Protein
TP306455

USD 823.00

In Stock

Recombinant protein of human pyruvate kinase, liver and RBC (PKLR), nuclear gene encoding mitochondrial protein, transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T

Special Offer: Get a 20% discount on this product. Use code: "MVPro20".

Pyruvate Kinase (PKLR) (NM_181871) Human Tagged ORF Clone
RG212337

USD 550.00

In Stock

PKLR (GFP-tagged) - Human pyruvate kinase, liver and RBC (PKLR), nuclear gene encoding mitochondrial protein, transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Pyruvate Kinase (PKLR) (NM_000298) Human Tagged ORF Clone Lentiviral Particle
RC206455L2V

USD 820.00

3 Weeks

Lenti ORF particles, PKLR (mGFP-tagged) - Human pyruvate kinase, liver and RBC (PKLR), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
Pyruvate Kinase (PKLR) (NM_181871) Human Tagged ORF Clone Lentiviral Particle
RC212337L2V

USD 900.00

3 Weeks

Lenti ORF particles, PKLR (mGFP-tagged)-Human pyruvate kinase, liver and RBC (PKLR), nuclear gene encoding mitochondrial protein, transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
Pyruvate Kinase (PKLR) (NM_000298) Human Tagged ORF Clone
RG206455

USD 460.00

In Stock

PKLR (GFP-tagged) - Human pyruvate kinase, liver and RBC (PKLR), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Pyruvate Kinase (PKLR) (NM_000298) Human Tagged ORF Clone Lentiviral Particle
RC206455L1V

USD 820.00

3 Weeks

Lenti ORF particles, PKLR (Myc-DDK tagged) - Human pyruvate kinase, liver and RBC (PKLR), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
Pyruvate Kinase (PKLR) (NM_181871) Human Tagged ORF Clone
RC212337

USD 500.00

In Stock

PKLR (Myc-DDK-tagged)-Human pyruvate kinase, liver and RBC (PKLR), nuclear gene encoding mitochondrial protein, transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Pyruvate Kinase (PKLR) (NM_181871) Human Tagged ORF Clone Lentiviral Particle
RC212337L1V

USD 900.00

6 Weeks

Lenti ORF particles, PKLR (Myc-DDK-tagged)-Human pyruvate kinase, liver and RBC (PKLR), nuclear gene encoding mitochondrial protein, transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
Pyruvate Kinase (PKLR) (NM_000298) Human Tagged ORF Clone
RC206455L4

USD 620.00

In Stock

Lenti ORF clone of Human pyruvate kinase, liver and RBC (PKLR), nuclear gene encoding mitochondrial protein, transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Pyruvate Kinase (PKLR) (NM_181871) Human Tagged ORF Clone
RC212337L4

USD 700.00

In Stock

Lenti-ORF clone of PKLR (mGFP-tagged)-Human pyruvate kinase, liver and RBC (PKLR), nuclear gene encoding mitochondrial protein, transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Pyruvate Kinase (PKLR) (NM_181871) Human Tagged ORF Clone Lentiviral Particle
RC212337L4V

USD 900.00

3 Weeks

Lenti ORF particles, PKLR (mGFP-tagged)-Human pyruvate kinase, liver and RBC (PKLR), nuclear gene encoding mitochondrial protein, transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Pyruvate Kinase (PKLR) (NM_000298) Human Tagged ORF Clone Lentiviral Particle
RC206455L4V

USD 820.00

3 Weeks

Lenti ORF particles, PKLR (mGFP-tagged) - Human pyruvate kinase, liver and RBC (PKLR), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Pyruvate Kinase (PKLR) (NM_181871) Human Tagged ORF Clone
RC212337L3

USD 700.00

3 Weeks

Lenti-ORF clone of PKLR (Myc-DDK-tagged)-Human pyruvate kinase, liver and RBC (PKLR), nuclear gene encoding mitochondrial protein, transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Pyruvate Kinase (PKLR) (NM_181871) Human Tagged ORF Clone Lentiviral Particle
RC212337L3V

USD 900.00

8 Weeks

Lenti ORF particles, PKLR (Myc-DDK-tagged)-Human pyruvate kinase, liver and RBC (PKLR), nuclear gene encoding mitochondrial protein, transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Pyruvate Kinase (PKLR) (NM_000298) Human Untagged Clone
SC321691

USD 760.00

In Stock

PKLR (untagged)-Human pyruvate kinase, liver and RBC (PKLR), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
Pyruvate Kinase (PKLR) Rabbit Polyclonal Antibody
TA346172

USD 410.00

5 Days

Rabbit Polyclonal Anti-PKLR Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PKLR antibody: synthetic peptide directed towards the N terminal of human PKLR. Synthetic peptide located within the following region: STSIIATIGPASRSVERLKEMIKAGMNIARLNFSHGSHEYHAESIANVRE
PKLR (47-574, His-tag) Human Protein
AR09652PU-L

USD 1,105.00

2 Weeks

PKLR (47-574, His-tag) human recombinant protein, 0.25 mg

Tag His-tag
Expression Host E. coli
PKLR (47-574, His-tag) Human Protein
AR09652PU-N

USD 415.00

2 Weeks

PKLR (47-574, His-tag) human recombinant protein, 50 µg

Tag His-tag
Expression Host E. coli
Pyruvate Kinase (PKLR) (NM_000298) Human Tagged ORF Clone
RC206455L1

USD 620.00

In Stock

Lenti ORF clone of Human pyruvate kinase, liver and RBC (PKLR), nuclear gene encoding mitochondrial protein, transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
Pyruvate Kinase (PKLR) (NM_181871) Human Tagged ORF Clone
RC212337L1

USD 700.00

3 Weeks

Lenti-ORF clone of PKLR (Myc-DDK-tagged)-Human pyruvate kinase, liver and RBC (PKLR), nuclear gene encoding mitochondrial protein, transcript variant 2

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
Pyruvate Kinase (PKLR) Rabbit Polyclonal Antibody
TA308453

USD 415.00

5 Days

Rabbit Polyclonal antibody to Pyruvate Kinase (liver/RBC) (pyruvate kinase, liver and RBC)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 260 of Pyruvate Kinase (liver/RBC) (Uniprot ID#P30613)
Pyruvate Kinase (PKLR) (NM_000298) Human Over-expression Lysate
LC400113

USD 121.00

In Stock

PKLR HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Pyruvate Kinase (PKLR) Mouse Monoclonal Antibody [Clone ID: OTI1A5]
CF501411

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) PKLR mouse monoclonal antibody, clone OTI1A5 (formerly 1A5)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Pyruvate Kinase (PKLR) Mouse Monoclonal Antibody [Clone ID: OTI1F3]
CF501412

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) PKLR mouse monoclonal antibody, clone OTI1F3 (formerly 1F3)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Pyruvate Kinase (PKLR) Mouse Monoclonal Antibody [Clone ID: OTI1H4]
CF501413

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) PKLR mouse monoclonal antibody, clone OTI1H4 (formerly 1H4)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Pyruvate Kinase (PKLR) Mouse Monoclonal Antibody [Clone ID: OTI1H9]
CF501414

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) PKLR mouse monoclonal antibody, clone OTI1H9 (formerly 1H9)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Pyruvate Kinase (PKLR) Mouse Monoclonal Antibody [Clone ID: OTI1H2]
CF501416

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) PKLR mouse monoclonal antibody, clone OTI1H2 (formerly 1H2)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Pyruvate Kinase (PKLR) Mouse Monoclonal Antibody [Clone ID: OTI1B4]
CF501417

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) PKLR mouse monoclonal antibody, clone OTI1B4 (formerly 1B4)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Pyruvate Kinase (PKLR) Mouse Monoclonal Antibody [Clone ID: OTI1G9]
CF501418

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) PKLR mouse monoclonal antibody, clone OTI1G9 (formerly 1G9)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Pyruvate Kinase (PKLR) Mouse Monoclonal Antibody [Clone ID: OTI1C7]
CF501472

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) PKLR mouse monoclonal antibody, clone OTI1C7 (formerly 1C7)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Pyruvate Kinase (PKLR) (NM_000298) Human Over-expression Lysate
LY400113

USD 396.00

5 Days

Transient overexpression lysate of pyruvate kinase, liver and RBC (PKLR), nuclear gene encoding mitochondrial protein, transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Pyruvate Kinase (PKLR) (NM_000298) Human Mass Spec Standard
PH306455

USD 2,055.00

3 Weeks

PKLR MS Standard C13 and N15-labeled recombinant protein (NP_000289)

Tag C-Myc/DDK
Expression Host HEK293
Pyruvate Kinase (PKLR) (NM_000298) Human Tagged ORF Clone Lentiviral Particle
RC206455L3V

USD 820.00

7 Weeks

Lenti ORF particles, PKLR (Myc-DDK tagged) - Human pyruvate kinase, liver and RBC (PKLR), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Pyruvate Kinase (PKLR) (NM_181871) Human Untagged Clone
SC313931

USD 920.00

4 Weeks

PKLR (untagged)-Human pyruvate kinase, liver and RBC (PKLR), nuclear gene encoding mitochondrial protein, transcript variant 2

Vector pCMV6 series
Tag Tag Free
Pyruvate Kinase (PKLR) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1H4]
TA501413AM

USD 420.00

4 Weeks

PKLR mouse monoclonal antibody, clone OTI1H4 (formerly 1H4), Biotinylated

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin