Germany
Japan
United Kingdom
China
Purified recombinant protein of Homo sapiens alanyl (membrane) aminopeptidase (ANPEP)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Products
View as table Download
ANPEP (Myc-DDK-tagged)-Human alanyl (membrane) aminopeptidase (ANPEP)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF particles, ANPEP (Myc-DDK-tagged)-Human alanyl (membrane) aminopeptidase (ANPEP), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, ANPEP (mGFP-tagged)-Human alanyl (membrane) aminopeptidase (ANPEP), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
ANPEP (GFP-tagged) - Human alanyl (membrane) aminopeptidase (ANPEP)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF particles, ANPEP (Myc-DDK-tagged)-Human alanyl (membrane) aminopeptidase (ANPEP), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of ANPEP (mGFP-tagged)-Human alanyl (membrane) aminopeptidase (ANPEP)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, ANPEP (mGFP-tagged)-Human alanyl (membrane) aminopeptidase (ANPEP), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
ANPEP (untagged)-Human alanyl (membrane) aminopeptidase (ANPEP)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
SC119422 is the updated version of SC125423.
Rabbit anti-ANPEP Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ANPEP |
CD13 (ANPEP) mouse monoclonal antibody, clone B-F10, PE
| Applications | FC |
| Reactivities | Human |
| Conjugation | PE |
CD13 (ANPEP) mouse monoclonal antibody, clone WM15, Biotin
| Applications | FC |
| Reactivities | Human, Primate |
| Conjugation | Biotin |
Rabbit Polyclonal Anti-ANPEP Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ANPEP antibody: synthetic peptide directed towards the N terminal of human ANPEP. Synthetic peptide located within the following region: VGGSQPPDIDKTELVEPTEYLVVHLKGSLVKDSQYEMDSEFEGELADDLA |
CD13 (ANPEP) mouse monoclonal antibody, clone B-F10, Azide Free
| Applications | FC |
| Reactivities | Human |
CD13 (ANPEP) mouse monoclonal antibody, clone B-F10, FITC
| Applications | FC |
| Reactivities | Human |
| Conjugation | FITC |
CD13 (ANPEP) mouse monoclonal antibody, clone B-F10, Purified
| Applications | FC |
| Reactivities | Human |
CD13 (ANPEP) mouse monoclonal antibody, clone WM15, APC
| Applications | FC |
| Reactivities | Human, Primate |
| Conjugation | APC |
CD13 (ANPEP) mouse monoclonal antibody, clone WM15, FITC
| Applications | FC |
| Reactivities | Human, Primate |
| Conjugation | FITC |
CD13 (ANPEP) mouse monoclonal antibody, clone WM15, PE
| Applications | FC |
| Reactivities | Human, Primate |
| Conjugation | PE |
Mouse Anti-Human CD13 Purified (100 ug)
| Applications | FC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Goat Anti-CD13 / ANPEP (aa79-91) Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-TLKPDSYRVTLRP, from the internal region (near N terminus) of the protein sequence according to NP_001141.2 |
Goat Anti-CD13 / ANPEP Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-QLEQFKKDNEET, from the internal region (near C terminus) of the protein sequence according to NP_001141.2 |
ANPEP MS Standard C13 and N15-labeled recombinant protein (NP_001141)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Rabbit Polyclonal Anti-ANPEP Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human ANPEP |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
Transient overexpression of ANPEP (NM_001150) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of ANPEP (NM_001150) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of ANPEP (NM_001150) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- ANPEP
Pathways
- Hematopoietic cell lineage