Purified recombinant protein of Homo sapiens alanyl (membrane) aminopeptidase (ANPEP)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Purified recombinant protein of Homo sapiens alanyl (membrane) aminopeptidase (ANPEP)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
ANPEP (Myc-DDK-tagged)-Human alanyl (membrane) aminopeptidase (ANPEP)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, ANPEP (Myc-DDK-tagged)-Human alanyl (membrane) aminopeptidase (ANPEP), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, ANPEP (mGFP-tagged)-Human alanyl (membrane) aminopeptidase (ANPEP), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
ANPEP (GFP-tagged) - Human alanyl (membrane) aminopeptidase (ANPEP)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, ANPEP (Myc-DDK-tagged)-Human alanyl (membrane) aminopeptidase (ANPEP), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of ANPEP (mGFP-tagged)-Human alanyl (membrane) aminopeptidase (ANPEP)
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, ANPEP (mGFP-tagged)-Human alanyl (membrane) aminopeptidase (ANPEP), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Rabbit monoclonal antibody against CD13(clone EPR4058)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
ANPEP (untagged)-Human alanyl (membrane) aminopeptidase (ANPEP)
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
CD13 (ANPEP) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | Synthetic peptide, corresponding to amino acids 880-930 of Human CD13. |
Rabbit anti-ANPEP Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ANPEP |
CD13 (ANPEP) mouse monoclonal antibody, clone B-F10, PE
Applications | FC |
Reactivities | Human |
Conjugation | PE |
CD13 (ANPEP) mouse monoclonal antibody, clone WM15, Biotin
Applications | FC |
Reactivities | Human, Primate |
Conjugation | Biotin |
Rabbit Polyclonal Anti-ANPEP Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ANPEP antibody: synthetic peptide directed towards the N terminal of human ANPEP. Synthetic peptide located within the following region: VGGSQPPDIDKTELVEPTEYLVVHLKGSLVKDSQYEMDSEFEGELADDLA |
CD13 (ANPEP) mouse monoclonal antibody, clone B-F10, Azide Free
Applications | FC |
Reactivities | Human |
CD13 (ANPEP) mouse monoclonal antibody, clone B-F10, FITC
Applications | FC |
Reactivities | Human |
Conjugation | FITC |
CD13 (ANPEP) mouse monoclonal antibody, clone B-F10, Purified
Applications | FC |
Reactivities | Human |
CD13 (ANPEP) mouse monoclonal antibody, clone WM15, APC
Applications | FC |
Reactivities | Human, Primate |
Conjugation | APC |
CD13 (ANPEP) mouse monoclonal antibody, clone WM15, FITC
Applications | FC |
Reactivities | Human, Primate |
Conjugation | FITC |
CD13 (ANPEP) mouse monoclonal antibody, clone WM15, PE
Applications | FC |
Reactivities | Human, Primate |
Conjugation | PE |
Mouse Anti-Human CD13 Purified (100 ug)
Applications | FC |
Reactivities | Human |
Conjugation | Unconjugated |
Goat Anti-CD13 / ANPEP (aa79-91) Polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-TLKPDSYRVTLRP, from the internal region (near N terminus) of the protein sequence according to NP_001141.2 |
Goat Anti-CD13 / ANPEP Polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-QLEQFKKDNEET, from the internal region (near C terminus) of the protein sequence according to NP_001141.2 |
Carrier-free (BSA/glycerol-free) ANPEP mouse monoclonal antibody, clone OTI2E4 (formerly 2E4)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ANPEP mouse monoclonal antibody, clone OTI2F10 (formerly 2F10)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ANPEP mouse monoclonal antibody, clone OTI3F8 (formerly 3F8)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
ANPEP MS Standard C13 and N15-labeled recombinant protein (NP_001141)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
Rabbit Polyclonal Anti-ANPEP Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human ANPEP |
ANPEP mouse monoclonal antibody, clone OTI2E4 (formerly 2E4)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
ANPEP mouse monoclonal antibody, clone OTI2E4 (formerly 2E4), Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
4 Weeks
ANPEP mouse monoclonal antibody, clone OTI2E4 (formerly 2E4), HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
ANPEP mouse monoclonal antibody, clone OTI2E4 (formerly 2E4)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
ANPEP mouse monoclonal antibody, clone OTI2F10 (formerly 2F10)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
ANPEP mouse monoclonal antibody, clone OTI2F10 (formerly 2F10), Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
4 Weeks
ANPEP mouse monoclonal antibody, clone OTI2F10 (formerly 2F10), HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
ANPEP mouse monoclonal antibody, clone OTI2F10 (formerly 2F10)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
ANPEP mouse monoclonal antibody, clone OTI3F8 (formerly 3F8)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
ANPEP mouse monoclonal antibody, clone OTI3F8 (formerly 3F8), Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
4 Weeks
ANPEP mouse monoclonal antibody, clone OTI3F8 (formerly 3F8), HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
ANPEP mouse monoclonal antibody, clone OTI3F8 (formerly 3F8)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Transient overexpression of ANPEP (NM_001150) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of ANPEP (NM_001150) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of ANPEP (NM_001150) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
CD13 mouse monoclonal antibody,clone UMAB275
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CD13 mouse monoclonal antibody,clone UMAB275
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
CD13 mouse monoclonal antibody,clone UMAB275
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |