Products

cDNA Clones (21)
Proteins (18)
Antibodies (6)
Jump to Filters
View as table Download
Triosephosphate isomerase (TPI1) (NM_000365) Human Tagged ORF Clone
RG202652

USD 460.00

In Stock

TPI1 (GFP-tagged) - Human triosephosphate isomerase 1 (TPI1), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Triosephosphate isomerase (TPI1) (NM_000365) Human Tagged ORF Clone Lentiviral Particle
RC202652L3V

USD 820.00

5 Weeks

Lenti ORF particles, TPI1 (Myc-DDK tagged) - Human triosephosphate isomerase 1 (TPI1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Triosephosphate isomerase (TPI1) (NM_000365) Human Tagged ORF Clone Lentiviral Particle
RC202652L4V

USD 820.00

3 Weeks

Lenti ORF particles, TPI1 (mGFP-tagged) - Human triosephosphate isomerase 1 (TPI1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Triosephosphate isomerase (TPI1) (NM_001159287) Human Tagged ORF Clone Lentiviral Particle
RC228219L3V

USD 820.00

6 Weeks

Lenti ORF particles, TPI1 (Myc-DDK-tagged)-Human triosephosphate isomerase 1 (TPI1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Triosephosphate isomerase (TPI1) (NM_001159287) Human Tagged ORF Clone Lentiviral Particle
RC228219L4V

USD 820.00

6 Weeks

Lenti ORF particles, TPI1 (mGFP-tagged)-Human triosephosphate isomerase 1 (TPI1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Triosephosphate isomerase (TPI1) (NM_001258026) Human Tagged ORF Clone
RC231935

USD 420.00

3 Weeks

TPI1 (Myc-DDK tagged) - Homo sapiens triosephosphate isomerase 1 (TPI1), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Triosephosphate isomerase (TPI1) (NM_000365) Human Untagged Clone
SC111041

USD 310.00

In Stock

TPI1 (untagged)-Human triosephosphate isomerase 1 (TPI1), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
Triosephosphate isomerase (TPI1) Rabbit Polyclonal Antibody
TA346536

USD 475.00

5 Days

Rabbit Polyclonal Anti-TPI1 Antibody

Applications WB
Reactivities Drosophila, Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TPI1 antibody: synthetic peptide directed towards the N terminal of human TPI1. Synthetic peptide located within the following region: MAPSRKFFVGGNWKMNGRKQSLGELIGTLNAAKVPADTEVVCAPPTAYID
Triosephosphate isomerase (TPI1) Goat Polyclonal Antibody
TA302993

USD 375.00

In Stock

Goat Polyclonal Antibody against TPI1

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Peptide with sequence C-LKPEFVDIINAKQ, from the C Terminus of the protein sequence according to NP_000356.
Triosephosphate isomerase (TPI1) Rabbit Polyclonal Antibody
TA308459

USD 415.00

5 Days

Rabbit Polyclonal antibody to Triosephosphate isomerase (triosephosphate isomerase 1)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 187 and 249 of Triosephosphate isomerase (Uniprot ID#P60174)
Triosephosphate isomerase (TPI1) Rabbit Polyclonal Antibody
TA332565

USD 275.00

3 Weeks

Rabbit anti-TPI1 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human TPI1
Triosephosphate isomerase (TPI1) (NM_000365) Human Over-expression Lysate
LC424764

USD 121.00

In Stock

TPI1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Triosephosphate isomerase (TPI1) (NM_000365) Human Over-expression Lysate
LY424764

USD 396.00

5 Days

Transient overexpression lysate of triosephosphate isomerase 1 (TPI1), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Triosephosphate isomerase (TPI1) (NM_000365) Human Untagged Clone
SC320334

USD 310.00

In Stock

TPI1 (untagged)-Human triosephosphate isomerase 1 (TPI1), transcript variant 1

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
Triosephosphate isomerase (TPI1) (C-term) Rabbit Polyclonal Antibody
AP17803PU-N

USD 450.00

2 Weeks

Triosephosphate isomerase (TPI1) (C-term) rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide selected from the ?-terminal region of human TPI1 Antibody (C-term)
Triosephosphate isomerase (TPI1) (N-term) Rabbit Polyclonal Antibody
AP17804PU-N

USD 450.00

2 Weeks

Triosephosphate isomerase (TPI1) (N-term) rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide selected from the N-terminal region of human TPI1
Triosephosphate isomerase (TPI1) (1-249, His-tag) Human Protein
AR09702PU-L

USD 845.00

2 Weeks

Triosephosphate isomerase (TPI1) (1-249, His-tag) human recombinant protein, 0.5 mg

Tag His-tag
Expression Host E. coli
Triosephosphate isomerase (TPI1) (1-249, His-tag) Human Protein
AR09702PU-N

USD 330.00

2 Weeks

Triosephosphate isomerase (TPI1) (1-249, His-tag) human recombinant protein, 0.1 mg

Tag His-tag
Expression Host E. coli
Triosephosphate isomerase (TPI1) ICC Control Block
TB402652

USD 1,040.00

4 Weeks

Transient overexpression of TPI1 (NM_000365) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Triosephosphate isomerase (TPI1) ICC Control Block
TB428219

USD 1,070.00

4 Weeks

Transient overexpression of TPI1 (NM_001159287) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Triosephosphate isomerase (TPI1) ICC Control Block
TB431935

USD 1,070.00

4 Weeks

Transient overexpression of TPI1 (NM_001258026) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Triosephosphate isomerase (TPI1) Cytosection
TS402652

USD 225.00

4 Weeks

Transient overexpression of TPI1 (NM_000365) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Triosephosphate isomerase (TPI1) Cytosection
TS402652P5

USD 889.00

4 Weeks

Transient overexpression of TPI1 (NM_000365) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Triosephosphate isomerase (TPI1) Cytosection
TS428219

USD 225.00

4 Weeks

Transient overexpression of TPI1 (NM_001159287) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Triosephosphate isomerase (TPI1) Cytosection
TS428219P5

USD 889.00

4 Weeks

Transient overexpression of TPI1 (NM_001159287) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Triosephosphate isomerase (TPI1) ICC Control Sections
TS431935P5

USD 889.00

4 Weeks

Transient overexpression of TPI1 (NM_001258026) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack