Products

Antibodies (24)
cDNA Clones (15)
Proteins (7)
Jump to Filters
View as table Download
GRF2 (RAPGEF1) (NM_198679) Human Tagged ORF Clone
RC208092

USD 1,150.00

In Stock

RAPGEF1 (Myc-DDK-tagged)-Human Rap guanine nucleotide exchange factor (GEF) 1 (RAPGEF1), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
GRF2 (RAPGEF1) (NM_198679) Human Tagged ORF Clone
RG208092

USD 1,260.00

In Stock

RAPGEF1 (GFP-tagged) - Human Rap guanine nucleotide exchange factor (GEF) 1 (RAPGEF1), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
GRF2 (RAPGEF1) (NM_198679) Human Tagged ORF Clone
RC208092L3

USD 1,350.00

3 Weeks

Lenti ORF clone of Human Rap guanine nucleotide exchange factor (GEF) 1 (RAPGEF1), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
GRF2 (RAPGEF1) (NM_198679) Human Tagged ORF Clone Lentiviral Particle
RC208092L3V

USD 1,550.00

6 Weeks

Lenti ORF particles, RAPGEF1 (Myc-DDK tagged) - Human Rap guanine nucleotide exchange factor (GEF) 1 (RAPGEF1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
GRF2 (RAPGEF1) (NM_198679) Human Tagged ORF Clone
RC208092L4

USD 1,350.00

3 Weeks

Lenti ORF clone of Human Rap guanine nucleotide exchange factor (GEF) 1 (RAPGEF1), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GRF2 (RAPGEF1) (NM_198679) Human Tagged ORF Clone Lentiviral Particle
RC208092L4V

USD 1,550.00

6 Weeks

Lenti ORF particles, RAPGEF1 (mGFP-tagged) - Human Rap guanine nucleotide exchange factor (GEF) 1 (RAPGEF1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GRF2 (RAPGEF1) (NM_005312) Human Tagged ORF Clone
RC221671

USD 1,130.00

3 Weeks

RAPGEF1 (Myc-DDK-tagged)-Human Rap guanine nucleotide exchange factor (GEF) 1 (RAPGEF1), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
GRF2 (RAPGEF1) (NM_005312) Human Tagged ORF Clone
RC221671L3

USD 1,330.00

5 Weeks

Lenti-ORF clone of RAPGEF1 (Myc-DDK-tagged)-Human Rap guanine nucleotide exchange factor (GEF) 1 (RAPGEF1), transcript variant 1

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
GRF2 (RAPGEF1) (NM_005312) Human Tagged ORF Clone Lentiviral Particle
RC221671L3V

USD 1,530.00

8 Weeks

Lenti ORF particles, RAPGEF1 (Myc-DDK-tagged)-Human Rap guanine nucleotide exchange factor (GEF) 1 (RAPGEF1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
GRF2 (RAPGEF1) (NM_005312) Human Tagged ORF Clone
RC221671L4

USD 1,330.00

5 Weeks

Lenti-ORF clone of RAPGEF1 (mGFP-tagged)-Human Rap guanine nucleotide exchange factor (GEF) 1 (RAPGEF1), transcript variant 1

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GRF2 (RAPGEF1) (NM_005312) Human Tagged ORF Clone Lentiviral Particle
RC221671L4V

USD 1,530.00

8 Weeks

Lenti ORF particles, RAPGEF1 (mGFP-tagged)-Human Rap guanine nucleotide exchange factor (GEF) 1 (RAPGEF1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GRF2 (RAPGEF1) (NM_005312) Human Tagged ORF Clone
RG221671

USD 1,240.00

6 Weeks

RAPGEF1 (GFP-tagged) - Human Rap guanine nucleotide exchange factor (GEF) 1 (RAPGEF1), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
GRF2 (RAPGEF1) (NM_198679) Human Over-expression Lysate
LY404802

USD 396.00

5 Days

Transient overexpression lysate of Rap guanine nucleotide exchange factor (GEF) 1 (RAPGEF1), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
GRF2 (RAPGEF1) (NM_198679) Human Untagged Clone
SC307763

USD 1,100.00

In Stock

RAPGEF1 (untagged)-Human Rap guanine nucleotide exchange factor (GEF) 1 (RAPGEF1), transcript variant 2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
GRF2 (RAPGEF1) (NM_198679) Human Over-expression Lysate
LC404802

USD 121.00

In Stock

RAPGEF1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
GRF2 (RAPGEF1) Rabbit Polyclonal Antibody
TA335090

USD 375.00

5 Days

Rabbit Polyclonal Anti-RAPGEF1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RAPGEF1 antibody: synthetic peptide directed towards the C terminal of human RAPGEF1. Synthetic peptide located within the following region: LWAKEQNEEKSPNLTQFTEHFNNMSYWVRSIIMLQEKAQDRERLLLKFIK
GRF2 (RAPGEF1) Mouse Monoclonal Antibody [Clone ID: OTI1F2]
CF506821

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) RAPGEF1 mouse monoclonal antibody, clone OTI1F2 (formerly 1F2)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
GRF2 (RAPGEF1) Mouse Monoclonal Antibody [Clone ID: OTI1B2]
CF506822

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) RAPGEF1 mouse monoclonal antibody, clone OTI1B2 (formerly 1B2)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
GRF2 (RAPGEF1) Mouse Monoclonal Antibody [Clone ID: OTI2F5]
CF506837

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) RAPGEF1 mouse monoclonal antibody, clone OTI2F5 (formerly 2F5)

Applications IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated
GRF2 (RAPGEF1) Mouse Monoclonal Antibody [Clone ID: OTI2C3]
CF506838

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) RAPGEF1 mouse monoclonal antibody, clone OTI2C3 (formerly 2C3)

Applications IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated
GRF2 (RAPGEF1) Mouse Monoclonal Antibody [Clone ID: OTI2B5]
CF506839

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) RAPGEF1 mouse monoclonal antibody, clone OTI2B5 (formerly 2B5)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
GRF2 (RAPGEF1) Mouse Monoclonal Antibody [Clone ID: OTI3H5]
CF506854

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) RAPGEF1 mouse monoclonal antibody, clone OTI3H5 (formerly 3H5)

Applications IF, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated
GRF2 (RAPGEF1) (BD140654) Human Untagged Clone
SC105577

USD 960.00

3 Weeks

(untagged)-36 Human secreted proteins

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
GRF2 (RAPGEF1) (NM_005312) Human Untagged Clone
SC315151

USD 2,180.00

6 Weeks

RAPGEF1 (untagged)-Human Rap guanine nucleotide exchange factor (GEF) 1 (RAPGEF1), transcript variant 1

Vector pCMV6 series
Tag Tag Free
GRF2 (RAPGEF1) Mouse Monoclonal Antibody [Clone ID: OTI1F2]
TA506821

USD 379.00

In Stock

RAPGEF1 mouse monoclonal antibody, clone OTI1F2 (formerly 1F2)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
GRF2 (RAPGEF1) Mouse Monoclonal Antibody [Clone ID: OTI1F2]
TA506821S

USD 159.00

2 Days

RAPGEF1 mouse monoclonal antibody, clone OTI1F2 (formerly 1F2)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
GRF2 (RAPGEF1) Mouse Monoclonal Antibody [Clone ID: OTI1B2]
TA506822

USD 379.00

In Stock

RAPGEF1 mouse monoclonal antibody, clone OTI1B2 (formerly 1B2)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
GRF2 (RAPGEF1) Mouse Monoclonal Antibody [Clone ID: OTI1B2]
TA506822S

USD 159.00

2 Days

RAPGEF1 mouse monoclonal antibody, clone OTI1B2 (formerly 1B2)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
GRF2 (RAPGEF1) Mouse Monoclonal Antibody [Clone ID: OTI2F5]
TA506837

USD 379.00

In Stock

RAPGEF1 mouse monoclonal antibody, clone OTI2F5 (formerly 2F5)

Applications IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated
GRF2 (RAPGEF1) Mouse Monoclonal Antibody [Clone ID: OTI2F5]
TA506837S

USD 159.00

2 Days

RAPGEF1 mouse monoclonal antibody, clone OTI2F5 (formerly 2F5)

Applications IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated
GRF2 (RAPGEF1) Mouse Monoclonal Antibody [Clone ID: OTI2C3]
TA506838

USD 379.00

In Stock

RAPGEF1 mouse monoclonal antibody, clone OTI2C3 (formerly 2C3)

Applications IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated
GRF2 (RAPGEF1) Mouse Monoclonal Antibody [Clone ID: OTI2C3]
TA506838S

USD 159.00

2 Days

RAPGEF1 mouse monoclonal antibody, clone OTI2C3 (formerly 2C3)

Applications IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated
GRF2 (RAPGEF1) Mouse Monoclonal Antibody [Clone ID: OTI2B5]
TA506839

USD 379.00

In Stock

RAPGEF1 mouse monoclonal antibody, clone OTI2B5 (formerly 2B5)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
GRF2 (RAPGEF1) Mouse Monoclonal Antibody [Clone ID: OTI2B5]
TA506839S

USD 159.00

2 Days

RAPGEF1 mouse monoclonal antibody, clone OTI2B5 (formerly 2B5)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
GRF2 (RAPGEF1) Mouse Monoclonal Antibody [Clone ID: OTI3H5]
TA506854

USD 379.00

In Stock

RAPGEF1 mouse monoclonal antibody, clone OTI3H5 (formerly 3H5)

Applications IF, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated
GRF2 (RAPGEF1) Mouse Monoclonal Antibody [Clone ID: OTI3H5]
TA506854S

USD 159.00

2 Days

RAPGEF1 mouse monoclonal antibody, clone OTI3H5 (formerly 3H5)

Applications IF, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated
GRF2 (RAPGEF1) ICC Control Block
TB408092

USD 1,800.00

4 Weeks

Transient overexpression of RAPGEF1 (NM_198679) in HEK293T cells paraffin embedded controls for ICC/IHC staining

GRF2 (RAPGEF1) ICC Control Block
TB421671

USD 1,780.00

4 Weeks

Transient overexpression of RAPGEF1 (NM_005312) in HEK293T cells paraffin embedded controls for ICC/IHC staining

GRF2 (RAPGEF1) Cytosection
TS408092

USD 225.00

4 Weeks

Transient overexpression of RAPGEF1 (NM_198679) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

GRF2 (RAPGEF1) Cytosection
TS408092P5

USD 889.00

4 Weeks

Transient overexpression of RAPGEF1 (NM_198679) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

GRF2 (RAPGEF1) ICC Control Sections
TS421671P5

USD 889.00

4 Weeks

Transient overexpression of RAPGEF1 (NM_005312) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

GRF2 (RAPGEF1) Mouse Monoclonal Antibody [Clone ID: UMAB140]
UM500102

USD 468.00

In Stock

RAPGEF1 mouse monoclonal antibody,clone UMAB140

Applications 10k-ChIP, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
GRF2 (RAPGEF1) Mouse Monoclonal Antibody [Clone ID: UMAB140]
UM500102CF

USD 528.00

4 Weeks

Carrier-free (BSA/glycerol-free) RAPGEF1 mouse monoclonal antibody,clone UMAB140

Applications 10k-ChIP, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
GRF2 (RAPGEF1) Mouse Monoclonal Antibody [Clone ID: UMAB140]
UM570102

USD 180.00

In Stock

RAPGEF1 mouse monoclonal antibody,clone UMAB140

Applications 10k-ChIP, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated