Germany
Japan
United Kingdom
China
CRLF2 (Myc-DDK-tagged)-Human cytokine receptor-like factor 2 (CRLF2), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Lenti ORF particles, CRLF2 (Myc-DDK tagged) - Human cytokine receptor-like factor 2 (CRLF2), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, CRLF2 (mGFP-tagged) - Human cytokine receptor-like factor 2 (CRLF2), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
CRLF2 (GFP-tagged) - Human cytokine receptor-like factor 2 (CRLF2), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human cytokine receptor-like factor 2 (CRLF2), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, CRLF2 (Myc-DDK tagged) - Human cytokine receptor-like factor 2 (CRLF2), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human cytokine receptor-like factor 2 (CRLF2), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, CRLF2 (mGFP-tagged) - Human cytokine receptor-like factor 2 (CRLF2), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
CRLF2 (Myc-DDK-tagged)-Human cytokine receptor-like factor 2 (CRLF2), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti-ORF clone of CRLF2 (Myc-DDK-tagged)-Human cytokine receptor-like factor 2 (CRLF2), transcript variant 2
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, CRLF2 (Myc-DDK-tagged)-Human cytokine receptor-like factor 2 (CRLF2), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of CRLF2 (mGFP-tagged)-Human cytokine receptor-like factor 2 (CRLF2), transcript variant 2
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, CRLF2 (mGFP-tagged)-Human cytokine receptor-like factor 2 (CRLF2), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
CRLF2 (GFP-tagged) - Human cytokine receptor-like factor 2 (CRLF2), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
CRLF2 (untagged)-Human cytokine receptor-like factor 2 (CRLF2), transcript variant 1
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti ORF clone of Human cytokine receptor-like factor 2 (CRLF2), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
CRLF2 (untagged)-Human cytokine receptor-like factor 2 (CRLF2), transcript variant 2
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Transient overexpression lysate of cytokine receptor-like factor 2 (CRLF2), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Lenti ORF clone of Human cytokine receptor-like factor 2 (CRLF2), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
CRLF2 mouse monoclonal antibody, clone AT4E7, Purified
| Applications | ELISA, WB |
| Reactivities | Human |
CRLF2 mouse monoclonal antibody, clone AT4E7, Purified
| Applications | ELISA, WB |
| Reactivities | Human |
CRLF2 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit Polyclonal Anti-CRLF2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CRLF2 Antibody: synthetic peptide directed towards the middle region of human CRLF2. Synthetic peptide located within the following region: FWVRVKAMEDVYGPDTYPSDWSEVTCWQRGEIRDACAETPTPPKPKLSKF |
CRLF2 (23-231, His-tag) human recombinant protein, 0.5 mg
| Tag | His-tag |
| Expression Host | E. coli |
CRLF2 (23-231, His-tag) human recombinant protein, 0.1 mg
| Tag | His-tag |
| Expression Host | E. coli |
CRLF2 MS Standard C13 and N15-labeled recombinant protein (NP_071431)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Transient overexpression of CRLF2 (NM_022148) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CRLF2 (NM_001012288) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CRLF2 (NM_022148) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CRLF2 (NM_022148) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of CRLF2 (NM_001012288) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- CRLF2
Pathways
- Jak-STAT signaling pathway