Products

cDNA Clones (20)
Proteins (10)
Antibodies (3)
Jump to Filters
View as table Download
Claudin 15 (CLDN15) (NM_138429) Human Tagged ORF Clone
RC203988

USD 98.00

USD 390.00

In Stock

CLDN15 (Myc-DDK-tagged)-Human claudin 15 (CLDN15), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Claudin 15 (CLDN15) (NM_138429) Human Tagged ORF Clone
RG203988

USD 460.00

In Stock

CLDN15 (GFP-tagged) - Human claudin 15 (CLDN15), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Claudin 15 (CLDN15) (NM_014343) Human Tagged ORF Clone
RC217239

USD 420.00

3 Weeks

CLDN15 (Myc-DDK-tagged)-Human claudin 15 (CLDN15), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Claudin 15 (CLDN15) (NM_014343) Human Tagged ORF Clone
RC217239L3

USD 620.00

3 Weeks

Lenti-ORF clone of CLDN15 (Myc-DDK-tagged)-Human claudin 15 (CLDN15), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Claudin 15 (CLDN15) (NM_014343) Human Tagged ORF Clone
RC217239L4

USD 620.00

3 Weeks

Lenti-ORF clone of CLDN15 (mGFP-tagged)-Human claudin 15 (CLDN15), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Claudin 15 (CLDN15) (NM_001185080) Human Tagged ORF Clone
RC233487

USD 420.00

3 Weeks

CLDN15 (Myc-DDK tagged) - Homo sapiens claudin 15 (CLDN15), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Claudin 15 (CLDN15) (NM_014343) Human Tagged ORF Clone
RG217239

USD 460.00

4 Weeks

CLDN15 (GFP-tagged) - Human claudin 15 (CLDN15), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Claudin 15 (CLDN15) (NM_001185080) Human Tagged ORF Clone
RG233487

USD 460.00

3 Weeks

CLDN15 (GFP-tagged) - Homo sapiens claudin 15 (CLDN15), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Claudin 15 (CLDN15) (NM_138429) Human Over-expression Lysate
LY408684

USD 396.00

In Stock

Transient overexpression lysate of claudin 15 (CLDN15), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Claudin 15 (CLDN15) (NM_138429) Human Tagged ORF Clone
RC203988L1

USD 620.00

In Stock

Lenti ORF clone of Human claudin 15 (CLDN15), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
Claudin 15 (CLDN15) (NM_014343) Human Untagged Clone
SC115054

USD 420.00

In Stock

CLDN15 (untagged)-Human claudin 15 (CLDN15), transcript variant 2

Vector pCMV6-XL6
Tag Tag Free
Mammalian Cell Selection None
Claudin 15 (CLDN15) (NM_138429) Human Tagged ORF Clone
RC203988L2

USD 620.00

3 Weeks

Lenti ORF clone of Human claudin 15 (CLDN15), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
Claudin 15 (CLDN15) (Center) Rabbit Polyclonal Antibody
AP50942PU-N

USD 450.00

2 Weeks

Claudin 15 (CLDN15) (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 135~165 amino acids from the Central region of human CLDN15
Claudin 15 (CLDN15) Rabbit Polyclonal Antibody
TA334207

USD 310.00

5 Days

Rabbit Polyclonal Anti-CLDN15 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CLDN15 antibody: synthetic peptide directed towards the C terminal of human CLDN15. Synthetic peptide located within the following region: LCSACCCGSDEDPAASARRPYQAPVSVMPVATSDQEGDSSFGKYGRNAYV
Claudin 15 (CLDN15) (NM_138429) Human Recombinant Protein
TP761793

USD 215.00

In Stock

Purified recombinant protein of Human claudin 15 (CLDN15), transcript variant 2, full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug

Tag N-GST and C-His
Expression Host E. coli
Claudin 15 (CLDN15) Rabbit Polyclonal Antibody
TA334208

USD 375.00

5 Days

Rabbit Polyclonal Anti-CLDN15 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CLDN15 antibody: synthetic peptide directed towards the middle region of human CLDN15. Synthetic peptide located within the following region: LSGYIQACRALMITAILLGFLGLLLGIAGLRCTNIGGLELSRKAKLAATA
Claudin 15 (CLDN15) (NM_138429) Human Over-expression Lysate
LC408684

USD 121.00

2 Weeks

CLDN15 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Claudin 15 (CLDN15) (NM_138429) ICC Control Block
TB403988

USD 1,040.00

4 Weeks

Transient overexpression of CLDN15 (NM_138429) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Claudin 15 (CLDN15) (NM_014343) ICC Control Block
TB417239

USD 1,070.00

4 Weeks

Transient overexpression of CLDN15 (NM_014343) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Claudin 15 (CLDN15) (NM_001185080) ICC Control Block
TB433487

USD 1,070.00

4 Weeks

Transient overexpression of CLDN15 (NM_001185080) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Claudin 15 (CLDN15) Cytosection
TS403988

USD 225.00

4 Weeks

Transient overexpression of CLDN15 (NM_138429) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Claudin 15 (CLDN15) ICC Control Sections
TS403988P5

USD 889.00

4 Weeks

Transient overexpression of CLDN15 (NM_138429) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Claudin 15 (CLDN15) ICC Control Sections
TS417239P5

USD 889.00

4 Weeks

Transient overexpression of CLDN15 (NM_014343) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Claudin 15 (CLDN15) ICC Control Sections
TS433487P5

USD 889.00

4 Weeks

Transient overexpression of CLDN15 (NM_001185080) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack