Products

View as table Download

CLDN15 (Myc-DDK-tagged)-Human claudin 15 (CLDN15), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Cldn15 (GFP-tagged) - Mouse claudin 15 (Cldn15)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Cldn15 (Myc-DDK-tagged) - Mouse claudin 15 (Cldn15)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

CLDN15 (GFP-tagged) - Human claudin 15 (CLDN15), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

CLDN15 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN403988 is the updated version of KN203988.

Cldn15 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN503406 is the updated version of KN303406.

Lenti ORF clone of Cldn15 (Myc-DDK-tagged) - Mouse claudin 15 (Cldn15)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Cldn15 (mGFP-tagged) - Mouse claudin 15 (Cldn15)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

CLDN15 (Myc-DDK-tagged)-Human claudin 15 (CLDN15), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti-ORF clone of CLDN15 (Myc-DDK-tagged)-Human claudin 15 (CLDN15), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti-ORF clone of CLDN15 (mGFP-tagged)-Human claudin 15 (CLDN15), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

CLDN15 (Myc-DDK tagged) - Homo sapiens claudin 15 (CLDN15), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

CLDN15 (GFP-tagged) - Human claudin 15 (CLDN15), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

CLDN15 (GFP-tagged) - Homo sapiens claudin 15 (CLDN15), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Cldn15 (Myc-DDK-tagged ORF) - Rat claudin 15 (Cldn15), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Cldn15 (Myc-DDK-tagged ORF) - Rat claudin 15 (Cldn15), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Cldn15 (mGFP-tagged ORF) - Rat claudin 15 (Cldn15), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Transient overexpression lysate of claudin 15 (CLDN15), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Lenti ORF clone of Human claudin 15 (CLDN15), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

CLDN15 (untagged)-Human claudin 15 (CLDN15), transcript variant 2

Vector pCMV6-XL6
Tag Tag Free
Mammalian Cell Selection None

CLDN15 rabbit polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human CLDN15

Cldn15 (untagged) - Mouse claudin 15 (Cldn15), (10ug)

Vector PCMV6-Kan/Neo
Tag Tag Free
Mammalian Cell Selection Neomycin

Lenti ORF clone of Human claudin 15 (CLDN15), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

Claudin 15 (CLDN15) (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 135~165 amino acids from the Central region of human CLDN15

Rabbit Polyclonal Anti-CLDN15 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CLDN15 antibody: synthetic peptide directed towards the C terminal of human CLDN15. Synthetic peptide located within the following region: LCSACCCGSDEDPAASARRPYQAPVSVMPVATSDQEGDSSFGKYGRNAYV

Purified recombinant protein of Human claudin 15 (CLDN15), transcript variant 2, full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug

Tag N-GST and C-His
Expression Host E. coli

Rabbit Polyclonal Anti-CLDN15 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CLDN15 antibody: synthetic peptide directed towards the middle region of human CLDN15. Synthetic peptide located within the following region: LSGYIQACRALMITAILLGFLGLLLGIAGLRCTNIGGLELSRKAKLAATA

CLDN15 CRISPRa kit - CRISPR gene activation of human claudin 15

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector

Cldn15 CRISPRa kit - CRISPR gene activation of mouse claudin 15

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector

qSTAR qPCR primer pairs against Homo sapiens gene CLDN15

CLDN15 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

qPCR primer pairs and template standards against Mus musculus gene Cldn15

Application Plasmid of exact quantity for transcript copy number calculation

qSTAR qPCR primer pairs against Mus musculus gene Cldn15

Cldn15 (untagged ORF) - Rat claudin 15 (Cldn15), (10 ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

3`UTR clone of claudin 15 (CLDN15) for miRNA target validation

Vector pMirTarget
Mammalian Cell Selection Neomycin
Species Human
Transfection Reporter RFP
Assay Reporter Luciferase

Cldn15 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100

SR426085 is the updated version of SR406215.

CLDN15 rabbit polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human CLDN15