CLDN18 (Myc-DDK-tagged)-Human claudin 18 (CLDN18), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
- TrueORF®
CLDN18 (Myc-DDK-tagged)-Human claudin 18 (CLDN18), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CLDN18 (Myc-DDK-tagged)-Human claudin 18 (CLDN18), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CLDN18 (GFP-tagged) - Human claudin 18 (CLDN18), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
CLDN18 (GFP-tagged) - Human claudin 18 (CLDN18), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
USD 820.00
3 Weeks
Lenti ORF particles, CLDN18 (mGFP-tagged) - Human claudin 18 (CLDN18), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
USD 820.00
6 Weeks
Lenti ORF particles, CLDN18 (Myc-DDK-tagged)-Human claudin 18 (CLDN18), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 820.00
6 Weeks
Lenti ORF particles, CLDN18 (mGFP-tagged)-Human claudin 18 (CLDN18), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
USD 820.00
2 Weeks
Lenti ORF particles, CLDN18 (mGFP-tagged) - Human claudin 18 (CLDN18), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of CLDN18 (Myc-DDK-tagged)-Human claudin 18 (CLDN18), transcript variant 1
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, CLDN18 (Myc-DDK-tagged)-Human claudin 18 (CLDN18), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human claudin 18 (CLDN18), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of CLDN18 (mGFP-tagged)-Human claudin 18 (CLDN18), transcript variant 1
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
CLDN18 (untagged)-Human claudin 18 (CLDN18), transcript variant 2
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
CLDN18 (untagged)-Human claudin 18 (CLDN18), transcript variant 1
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-CLDN18 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CLDN18 antibody: synthetic peptide directed towards the middle region of human CLDN18. Synthetic peptide located within the following region: LVTNFWMSTANMYTGMGGMVQTVQTRYTFGAALFVGWVAGGLTLIGGVMM |
Rabbit Polyclonal Anti-CLDN18 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CLDN18 antibody: synthetic peptide directed towards the C terminal of human CLDN18. Synthetic peptide located within the following region: PEETNYKAVSYHASGHSVAYKPGGFKASTGFGSNTKNKKIYDGGARTEDE |
Lenti-ORF clone of CLDN18 (Myc-DDK-tagged)-Human claudin 18 (CLDN18), transcript variant 1
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Lenti ORF clone of Human claudin 18 (CLDN18), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Lenti ORF clone of Human claudin 18 (CLDN18), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-CLDN18 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-CLDN18 Antibody: synthetic peptide directed towards the middle region of human CLDN18. Synthetic peptide located within the following region: YHASGHSVAYKPGGFKASTGFGSNTKNKKIYDGGARTEDEVQSYPSKHDY |
USD 820.00
3 Weeks
Lenti ORF particles, CLDN18 (mGFP-tagged)-Human claudin 18 (CLDN18), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Claudin18.2(CLDN18.2) Rabbit monoclonal antibody,clone OTIR56A8
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Claudin18.2(CLDN18.2) Rabbit monoclonal antibody,clone OTIR56A8
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Transient overexpression of CLDN18 (NM_016369) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CLDN18 (NM_001002026) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Purified recombinant protein of Human claudin 18 (CLDN18), transcript variant 2, 28Asp-78Ala-GGGGS-145Thr-167Thr, with N-terminal His tag, expressed in E.coli, 50ug
Tag | N-His |
Expression Host | E. coli |
Transient overexpression of CLDN18 (NM_016369) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CLDN18 (NM_016369) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of CLDN18 (NM_001002026) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CLDN18 (NM_001002026) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack