Products

cDNA Clones (22)
Proteins (18)
Antibodies (5)
Jump to Filters
View as table Download
Epac1 (RAPGEF3) (NM_001098532) Human Tagged ORF Clone
RC219138

USD 420.00

In Stock

RAPGEF3 (Myc-DDK-tagged)-Human Rap guanine nucleotide exchange factor (GEF) 3 (RAPGEF3), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Epac1 (RAPGEF3) (NM_006105) Human Tagged ORF Clone
RC204518

USD 420.00

In Stock

RAPGEF3 (Myc-DDK-tagged)-Human Rap guanine nucleotide exchange factor (GEF) 3 (RAPGEF3), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Epac1 (RAPGEF3) (NM_001098531) Human Tagged ORF Clone
RC219093

USD 420.00

In Stock

RAPGEF3 (Myc-DDK-tagged)-Human Rap guanine nucleotide exchange factor (GEF) 3 (RAPGEF3), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Epac1 (RAPGEF3) (NM_006105) Human Tagged ORF Clone
RG204518

USD 460.00

In Stock

RAPGEF3 (GFP-tagged) - Human Rap guanine nucleotide exchange factor (GEF) 3 (RAPGEF3), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Epac1 (RAPGEF3) (NM_001098531) Human Tagged ORF Clone
RC219093L3

USD 620.00

In Stock

Lenti-ORF clone of RAPGEF3 (Myc-DDK-tagged)-Human Rap guanine nucleotide exchange factor (GEF) 3 (RAPGEF3), transcript variant 1

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Epac1 (RAPGEF3) (NM_006105) Human Tagged ORF Clone
RC204518L3

USD 620.00

3 Weeks

Lenti ORF clone of Human Rap guanine nucleotide exchange factor (GEF) 3 (RAPGEF3), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Epac1 (RAPGEF3) (NM_006105) Human Tagged ORF Clone Lentiviral Particle
RC204518L3V

USD 820.00

6 Weeks

Lenti ORF particles, RAPGEF3 (Myc-DDK tagged) - Human Rap guanine nucleotide exchange factor (GEF) 3 (RAPGEF3), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Epac1 (RAPGEF3) (NM_006105) Human Tagged ORF Clone
RC204518L4

USD 620.00

3 Weeks

Lenti ORF clone of Human Rap guanine nucleotide exchange factor (GEF) 3 (RAPGEF3), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Epac1 (RAPGEF3) (NM_006105) Human Tagged ORF Clone Lentiviral Particle
RC204518L4V

USD 820.00

6 Weeks

Lenti ORF particles, RAPGEF3 (mGFP-tagged) - Human Rap guanine nucleotide exchange factor (GEF) 3 (RAPGEF3), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Epac1 (RAPGEF3) (NM_001098531) Human Tagged ORF Clone Lentiviral Particle
RC219093L3V

USD 820.00

3 Weeks

Lenti ORF particles, RAPGEF3 (Myc-DDK-tagged)-Human Rap guanine nucleotide exchange factor (GEF) 3 (RAPGEF3), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Epac1 (RAPGEF3) (NM_001098531) Human Tagged ORF Clone
RC219093L4

USD 620.00

3 Weeks

Lenti-ORF clone of RAPGEF3 (mGFP-tagged)-Human Rap guanine nucleotide exchange factor (GEF) 3 (RAPGEF3), transcript variant 1

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Epac1 (RAPGEF3) (NM_001098531) Human Tagged ORF Clone Lentiviral Particle
RC219093L4V

USD 820.00

6 Weeks

Lenti ORF particles, RAPGEF3 (mGFP-tagged)-Human Rap guanine nucleotide exchange factor (GEF) 3 (RAPGEF3), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Epac1 (RAPGEF3) (NM_001098532) Human Tagged ORF Clone
RC219138L3

USD 620.00

3 Weeks

Lenti ORF clone of Human Rap guanine nucleotide exchange factor (GEF) 3 (RAPGEF3), transcript variant 3, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Epac1 (RAPGEF3) (NM_001098532) Human Tagged ORF Clone Lentiviral Particle
RC219138L3V

USD 820.00

6 Weeks

Lenti ORF particles, RAPGEF3 (Myc-DDK tagged) - Human Rap guanine nucleotide exchange factor (GEF) 3 (RAPGEF3), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Epac1 (RAPGEF3) (NM_001098532) Human Tagged ORF Clone
RC219138L4

USD 620.00

3 Weeks

Lenti ORF clone of Human Rap guanine nucleotide exchange factor (GEF) 3 (RAPGEF3), transcript variant 3, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Epac1 (RAPGEF3) (NM_001098532) Human Tagged ORF Clone Lentiviral Particle
RC219138L4V

USD 820.00

6 Weeks

Lenti ORF particles, RAPGEF3 (mGFP-tagged) - Human Rap guanine nucleotide exchange factor (GEF) 3 (RAPGEF3), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Epac1 (RAPGEF3) (NM_001098531) Human Tagged ORF Clone
RG219093

USD 460.00

3 Weeks

RAPGEF3 (GFP-tagged) - Human Rap guanine nucleotide exchange factor (GEF) 3 (RAPGEF3), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Epac1 (RAPGEF3) (NM_001098532) Human Tagged ORF Clone
RG219138

USD 460.00

3 Weeks

RAPGEF3 (GFP-tagged) - Human Rap guanine nucleotide exchange factor (GEF) 3 (RAPGEF3), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Epac1 (RAPGEF3) (NM_006105) Human Untagged Clone
SC116327

USD 310.00

In Stock

RAPGEF3 (untagged)-Human Rap guanine nucleotide exchange factor (GEF) 3 (RAPGEF3), transcript variant 2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
Epac1 (RAPGEF3) (NM_001098531) Human Untagged Clone
SC316433

USD 760.00

In Stock

RAPGEF3 (untagged)-Human Rap guanine nucleotide exchange factor (GEF) 3 (RAPGEF3), transcript variant 1

Vector PCMV6-Neo
Tag Tag Free
Mammalian Cell Selection Neomycin
Epac1 (RAPGEF3) Rabbit Polyclonal Antibody
TA327333

USD 275.00

3 Weeks

Rabbit anti-RAPGEF3 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human RAPGEF3
Epac1 (RAPGEF3) (NM_006105) Human Untagged Clone
SC323918

USD 310.00

In Stock

RAPGEF3 (untagged)-Human Rap guanine nucleotide exchange factor (GEF) 3 (RAPGEF3), transcript variant 2

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
Epac1 (RAPGEF3) Rabbit Polyclonal Antibody
TA319816

USD 430.00

5 Days

Rabbit Polyclonal EPAC1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen EPAC1 antibody was raised against an 18 amino acid synthetic peptide near the amino terminus of human EPAC1.
Epac1 (RAPGEF3) (NM_006105) Human Over-expression Lysate
LC401841

USD 121.00

In Stock

RAPGEF3 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Epac1 (RAPGEF3) (NM_006105) Human Over-expression Lysate
LY401841

USD 396.00

5 Days

Transient overexpression lysate of Rap guanine nucleotide exchange factor (GEF) 3 (RAPGEF3), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Epac1 (RAPGEF3) Rabbit Polyclonal Antibody
TA340093

USD 375.00

5 Days

Rabbit Polyclonal Anti-RAPGEF3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RAPGEF3 antibody: synthetic peptide directed towards the middle region of human RAPGEF3. Synthetic peptide located within the following region: HGKVVLVLERASQGAGPSRPPTPGRNRYTVMSGTPEKILELLLEAMGPDS
Epac1 (RAPGEF3) Rabbit Polyclonal Antibody
TA340092

USD 375.00

5 Days

Rabbit Polyclonal Anti-RAPGEF3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RAPGEF3 antibody: synthetic peptide directed towards the N terminal of human RAPGEF3. Synthetic peptide located within the following region: RSQVVGICQVLLDEGALCHVKHDWAFQDRDAQFYRFPGPEPEPVGTHEME
Epac1 (RAPGEF3) (NM_001098532) Human Over-expression Lysate
LC420629

USD 187.00

2 Weeks

RAPGEF3 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Epac1 (RAPGEF3) (NM_001098532) Human Over-expression Lysate
LC426024

USD 187.00

2 Weeks

RAPGEF3 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Epac1 (RAPGEF3) (NM_001098532) Human Over-expression Lysate
LY420629

USD 605.00

5 Days

Transient overexpression lysate of Rap guanine nucleotide exchange factor (GEF) 3 (RAPGEF3), transcript variant 3

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
LY420629 is the same product as LY426024.
Epac1 (RAPGEF3) (NM_001098532) Human Over-expression Lysate
LY426024

USD 605.00

5 Days

Transient overexpression lysate of Rap guanine nucleotide exchange factor (GEF) 3 (RAPGEF3), transcript variant 3

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Epac1 (RAPGEF3) (NM_006105) Human Mass Spec Standard
PH304518

USD 2,055.00

3 Weeks

RAPGEF3 MS Standard C13 and N15-labeled recombinant protein (NP_006096)

Tag C-Myc/DDK
Expression Host HEK293
Epac1 (RAPGEF3) (NM_001098532) Human Mass Spec Standard
PH319138

USD 2,055.00

3 Weeks

RAPGEF3 MS Standard C13 and N15-labeled recombinant protein (NP_001092002)

Tag C-Myc/DDK
Expression Host HEK293
Epac1 (RAPGEF3) (NM_001098532) Human Untagged Clone
SC316430

USD 760.00

3 Weeks

RAPGEF3 (untagged)-Human Rap guanine nucleotide exchange factor (GEF) 3 (RAPGEF3), transcript variant 3

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Epac1 (RAPGEF3) (NM_006105) ICC Control Block
TB404518

USD 1,070.00

4 Weeks

Transient overexpression of RAPGEF3 (NM_006105) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Epac1 (RAPGEF3) (NM_001098531) ICC Control Block
TB419093

USD 1,070.00

4 Weeks

Transient overexpression of RAPGEF3 (NM_001098531) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Epac1 (RAPGEF3) (NM_001098532) ICC Control Block
TB419138

USD 1,070.00

4 Weeks

Transient overexpression of RAPGEF3 (NM_001098532) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Epac1 (RAPGEF3) Cytosection
TS404518

USD 225.00

4 Weeks

Transient overexpression of RAPGEF3 (NM_006105) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Epac1 (RAPGEF3) Cytosection
TS404518P5

USD 889.00

4 Weeks

Transient overexpression of RAPGEF3 (NM_006105) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Epac1 (RAPGEF3) Cytosection
TS419093

USD 225.00

4 Weeks

Transient overexpression of RAPGEF3 (NM_001098531) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Epac1 (RAPGEF3) Cytosection
TS419093P5

USD 889.00

4 Weeks

Transient overexpression of RAPGEF3 (NM_001098531) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Epac1 (RAPGEF3) Cytosection
TS419138

USD 225.00

4 Weeks

Transient overexpression of RAPGEF3 (NM_001098532) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Epac1 (RAPGEF3) Cytosection
TS419138P5

USD 889.00

4 Weeks

Transient overexpression of RAPGEF3 (NM_001098532) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack