Germany
Japan
United Kingdom
China
AASDHPPT (Myc-DDK-tagged)-Human aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase (AASDHPPT)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Recombinant protein of human aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase (AASDHPPT)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Lenti ORF clone of Human aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase (AASDHPPT), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, AASDHPPT (Myc-DDK tagged) - Human aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase (AASDHPPT), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase (AASDHPPT), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, AASDHPPT (mGFP-tagged) - Human aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase (AASDHPPT), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
AASDHPPT (GFP-tagged) - Human aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase (AASDHPPT)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Rabbit Polyclonal Anti-AASDHPPT Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-AASDHPPT antibody: synthetic peptide directed towards the C terminal of human AASDHPPT. Synthetic peptide located within the following region: SRHQDVPSQDDSKPTQRQFTILNFNDLMSSAVPMTPEDPSFWDCFCFTEE |
Rabbit polyclonal anti-AASDHPPT antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human AASDHPPT. |
AASDHPPT HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase (AASDHPPT)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
AASDHPPT (untagged)-Human aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase (AASDHPPT)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
AASDHPPT (untagged)-Human aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase (AASDHPPT)
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
AASDHPPT (14-309, His-tag) human recombinant protein, 0.5 mg
| Tag | His-tag |
| Expression Host | E. coli |
AASDHPPT (14-309, His-tag) human recombinant protein, 0.1 mg
| Tag | His-tag |
| Expression Host | E. coli |
AASDHPPT MS Standard C13 and N15-labeled recombinant protein (NP_056238)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Anti-AASDHPPT Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
Transient overexpression of AASDHPPT (NM_015423) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of AASDHPPT (NM_015423) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of AASDHPPT (NM_015423) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- AASDHPPT
Pathways
- Lysine biosynthesis