Germany
Japan
United Kingdom
China
MAPK10 (Myc-DDK-tagged)-Human mitogen-activated protein kinase 10 (MAPK10), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
MAPK10 (Myc-DDK-tagged)-Human mitogen-activated protein kinase 10 (MAPK10), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF particles, MAPK10 (Myc-DDK-tagged)-Human mitogen-activated protein kinase 10 (MAPK10), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, MAPK10 (mGFP-tagged)-Human mitogen-activated protein kinase 10 (MAPK10), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Lenti ORF particles, MAPK10 (Myc-DDK tagged) - Human mitogen-activated protein kinase 10 (MAPK10), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, MAPK10 (mGFP-tagged) - Human mitogen-activated protein kinase 10 (MAPK10), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Recombinant protein of human mitogen-activated protein kinase 10 (MAPK10), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
MAPK10 (Myc-DDK-tagged)-Human mitogen-activated protein kinase 10 (MAPK10), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
MAPK10 (GFP-tagged) - Human mitogen-activated protein kinase 10 (MAPK10), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
MAPK10 (GFP-tagged) - Human mitogen-activated protein kinase 10 (MAPK10), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF particles, MAPK10 (Myc-DDK-tagged)-Human mitogen-activated protein kinase 10 (MAPK10), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of MAPK10 (mGFP-tagged)-Human mitogen-activated protein kinase 10 (MAPK10), transcript variant 1
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, MAPK10 (mGFP-tagged)-Human mitogen-activated protein kinase 10 (MAPK10), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of MAPK10 (Myc-DDK-tagged)-Human mitogen-activated protein kinase 10 (MAPK10), transcript variant 3
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, MAPK10 (Myc-DDK-tagged)-Human mitogen-activated protein kinase 10 (MAPK10), transcript variant 3, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of MAPK10 (mGFP-tagged)-Human mitogen-activated protein kinase 10 (MAPK10), transcript variant 3
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, MAPK10 (mGFP-tagged)-Human mitogen-activated protein kinase 10 (MAPK10), transcript variant 3, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human mitogen-activated protein kinase 10 (MAPK10), transcript variant 2, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, MAPK10 (Myc-DDK tagged) - Human mitogen-activated protein kinase 10 (MAPK10), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human mitogen-activated protein kinase 10 (MAPK10), transcript variant 2, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, MAPK10 (mGFP-tagged) - Human mitogen-activated protein kinase 10 (MAPK10), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
MAPK10 (GFP-tagged) - Human mitogen-activated protein kinase 10 (MAPK10), transcript variant 3
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
MAPK10 (untagged)-Human mitogen-activated protein kinase 10 (MAPK10), transcript variant 1
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-MAPK10 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Rat, Tobacco hornworm |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Mapk10 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: RYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYREL |
Transient overexpression lysate of mitogen-activated protein kinase 10 (MAPK10), transcript variant 2
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Transient overexpression lysate of mitogen-activated protein kinase 10 (MAPK10), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Recombinant protein of human mitogen-activated protein kinase 10 (MAPK10), transcript variant 4, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug
| Tag | N-His |
| Expression Host | E. coli |
MAPK10 (untagged)-Human mitogen-activated protein kinase 10 (MAPK10), transcript variant 2
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
MAPK10 (untagged)-Kinase deficient mutant (K93M) of Human mitogen-activated protein kinase 10 (MAPK10), transcript variant 1
| Vector | pCMV6-XL6 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
MAPK10 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human MAPK10 |
MAPK10 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Lenti-ORF clone of MAPK10 (mGFP-tagged)-Human mitogen-activated protein kinase 10 (MAPK10), transcript variant 1
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human mitogen-activated protein kinase 10 (MAPK10), transcript variant 2, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
MAPK10 (untagged)-Kinase deficient mutant (K93M) of Human mitogen-activated protein kinase 10 (MAPK10), transcript variant 2
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit polyclonal anti-MAPK10 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human MAPK10. |
MAPK10 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Carrier-free (BSA/glycerol-free) JNK1 mouse monoclonal antibody,clone OTI10D8
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
MAPK10 MS Standard C13 and N15-labeled recombinant protein (NP_002744)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
MAPK10 MS Standard C13 and N15-labeled recombinant protein (NP_620448)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
MAPK10 (untagged)-Human mitogen-activated protein kinase 10 (MAPK10), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
JNK1 mouse monoclonal antibody,clone OTI10D8
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
JNK1 mouse monoclonal antibody,clone OTI10D8, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 420.00
4 Weeks
JNK1 mouse monoclonal antibody,clone OTI10D8, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
Active filters
Target Symbol
- MAPK10
Pathways
- MAPK signaling pathway