Products

Antibodies (24)

cDNA Clones (20)

Proteins (17)

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 50 of 61 results

Page 1 of 2

(reset)

Neurotrophin 3 (NTF3) (NM_002527) Human Tagged ORF Clone

RC214226

USD 98.00

USD 390.00

In Stock

NTF3 (Myc-DDK-tagged)-Human neurotrophin 3 (NTF3), transcript variant 2

Vector	pCMV6-Entry
Tag	Myc-DDK
Mammalian Cell Selection	Neomycin

• 

Neurotrophin 3 (NTF3) (NM_001102654) Human Tagged ORF Clone

RC214281

USD 420.00

In Stock

NTF3 (Myc-DDK-tagged)-Human neurotrophin 3 (NTF3), transcript variant 1

Vector	pCMV6-Entry
Tag	Myc-DDK
Mammalian Cell Selection	Neomycin

• 

Neurotrophin 3 (NTF3) (NM_002527) Human Tagged ORF Clone Lentiviral Particle

RC214226L1V

USD 820.00

3 Weeks

Lenti ORF particles, NTF3 (Myc-DDK tagged) - Human neurotrophin 3 (NTF3), transcript variant 2, 200ul, >10^7 TU/mL

Vector	pLenti-C-Myc-DDK
Tag	Myc-DDK

• LentiORF^®
• 

Neurotrophin 3 (NTF3) (NM_002527) Human Tagged ORF Clone Lentiviral Particle

RC214226L2V

USD 820.00

6 Weeks

Lenti ORF particles, NTF3 (mGFP-tagged) - Human neurotrophin 3 (NTF3), transcript variant 2, 200ul, >10^7 TU/mL

Vector	pLenti-C-mGFP
Tag	mGFP

• LentiORF^®
• 

Neurotrophin 3 (NTF3) (NM_001102654) Human Tagged ORF Clone Lentiviral Particle

RC214281L1V

USD 820.00

3 Weeks

Lenti ORF particles, NTF3 (Myc-DDK tagged) - Human neurotrophin 3 (NTF3), transcript variant 1, 200ul, >10^7 TU/mL

Vector	pLenti-C-Myc-DDK
Tag	Myc-DDK

• LentiORF^®
• 

Neurotrophin 3 (NTF3) (NM_001102654) Human Tagged ORF Clone Lentiviral Particle

RC214281L2V

USD 820.00

6 Weeks

Lenti ORF particles, NTF3 (mGFP-tagged) - Human neurotrophin 3 (NTF3), transcript variant 1, 200ul, >10^7 TU/mL

Vector	pLenti-C-mGFP
Tag	mGFP

• LentiORF^®
• 

Neurotrophin 3 (NTF3) (NM_002527) Human Tagged ORF Clone

RG214226

USD 460.00

In Stock

NTF3 (GFP-tagged) - Human neurotrophin 3 (NTF3), transcript variant 2

Vector	pCMV6-AC-GFP
Tag	TurboGFP
Mammalian Cell Selection	Neomycin

• TrueORF^®

Neurotrophin 3 (NTF3) (NM_001102654) Human Tagged ORF Clone

RG214281

USD 460.00

In Stock

NTF3 (GFP-tagged) - Human neurotrophin 3 (NTF3), transcript variant 1

Vector	pCMV6-AC-GFP
Tag	TurboGFP
Mammalian Cell Selection	Neomycin

• TrueORF^®

Neurotrophin 3 (NTF3) (NM_002527) Human Tagged ORF Clone

RC214226L3

USD 620.00

3 Weeks

Lenti ORF clone of Human neurotrophin 3 (NTF3), transcript variant 2, Myc-DDK-tagged

Vector	pLenti-C-Myc-DDK-P2A-Puro
Tag	Myc-DDK
Mammalian Cell Selection	Puromycin

• LentiORF^®

Neurotrophin 3 (NTF3) (NM_002527) Human Tagged ORF Clone Lentiviral Particle

RC214226L3V

USD 820.00

5 Weeks

Lenti ORF particles, NTF3 (Myc-DDK tagged) - Human neurotrophin 3 (NTF3), transcript variant 2, 200ul, >10^7 TU/mL

Vector	pLenti-C-Myc-DDK-P2A-Puro
Tag	Myc-DDK
Mammalian Cell Selection	Puromycin

• LentiORF^®
• 

Neurotrophin 3 (NTF3) (NM_002527) Human Tagged ORF Clone Lentiviral Particle

RC214226L4V

USD 820.00

3 Weeks

Lenti ORF particles, NTF3 (mGFP-tagged) - Human neurotrophin 3 (NTF3), transcript variant 2, 200ul, >10^7 TU/mL

Vector	pLenti-C-mGFP-P2A-Puro
Tag	mGFP
Mammalian Cell Selection	Puromycin

• LentiORF^®
• 

Neurotrophin 3 (NTF3) (NM_001102654) Human Tagged ORF Clone

RC214281L3

USD 620.00

3 Weeks

Lenti ORF clone of Human neurotrophin 3 (NTF3), transcript variant 1, Myc-DDK-tagged

Vector	pLenti-C-Myc-DDK-P2A-Puro
Tag	Myc-DDK
Mammalian Cell Selection	Puromycin

• LentiORF^®

Neurotrophin 3 (NTF3) (NM_001102654) Human Tagged ORF Clone Lentiviral Particle

RC214281L3V

USD 820.00

5 Weeks

Lenti ORF particles, NTF3 (Myc-DDK tagged) - Human neurotrophin 3 (NTF3), transcript variant 1, 200ul, >10^7 TU/mL

Vector	pLenti-C-Myc-DDK-P2A-Puro
Tag	Myc-DDK
Mammalian Cell Selection	Puromycin

• LentiORF^®
• 

Neurotrophin 3 (NTF3) (NM_001102654) Human Tagged ORF Clone Lentiviral Particle

RC214281L4V

USD 820.00

3 Weeks

Lenti ORF particles, NTF3 (mGFP-tagged) - Human neurotrophin 3 (NTF3), transcript variant 1, 200ul, >10^7 TU/mL

Vector	pLenti-C-mGFP-P2A-Puro
Tag	mGFP
Mammalian Cell Selection	Puromycin

• LentiORF^®
• 

Neurotrophin 3 (NTF3) (NM_001102654) Human Recombinant Protein

TP750019

USD 425.00

In Stock

Recombinant protein of human Neurotrophin-3 (NT3) produced in E. coli.

Tag	Tag Free
Expression Host	E. coli

Neurotrophin 3 (NTF3) (NM_001102654) Human Tagged ORF Clone

RC214281L4

USD 768.00

In Stock

Lenti ORF clone of Human neurotrophin 3 (NTF3), transcript variant 1, mGFP tagged

Vector	pLenti-C-mGFP-P2A-Puro
Tag	mGFP
Mammalian Cell Selection	Puromycin

• LentiORF^®

1 / 2

2 / 2

Previous Next

Neurotrophin 3 (NTF3) (NM_002527) Human Recombinant Protein

TP723338

USD 240.00

5 Days

Purified recombinant protein of Human neurotrophin 3 (NTF3), transcript variant 2.

Tag	Tag Free
Expression Host	E. coli

Neurotrophin 3 (NTF3) (NM_001102654) Human Tagged ORF Clone

RC214281L1

USD 620.00

In Stock

Lenti ORF clone of Human neurotrophin 3 (NTF3), transcript variant 1, Myc-DDK-tagged

Vector	pLenti-C-Myc-DDK
Tag	Myc-DDK
Mammalian Cell Selection	None

• LentiORF^®

Neurotrophin 3 (NTF3) (NM_002527) Human Untagged Clone

SC303212

USD 420.00

In Stock

NTF3 (untagged)-Human neurotrophin 3 (NTF3), transcript variant 2

Vector	pCMV6-XL5
Tag	Tag Free
Mammalian Cell Selection	None

Neurotrophin 3 (NTF3) (NM_001102654) Human Untagged Clone

SC316918

USD 660.00

In Stock

NTF3 (untagged)-Human neurotrophin 3 (NTF3), transcript variant 1

Vector	pCMV6-XL5
Tag	Tag Free
Mammalian Cell Selection	None

Neurotrophin 3 (NTF3) (NM_001102654) Human Over-expression Lysate

LY420181

USD 396.00

In Stock

Transient overexpression lysate of neurotrophin 3 (NTF3), transcript variant 1

Tag	C-Myc/DDK
Expression Host	HEK293T
Applications	WB

Neurotrophin 3 (NTF3) Rabbit Polyclonal Antibody

AP23334PU-N

USD 405.00

2 Weeks

Neurotrophin 3 (NTF3) rabbit polyclonal antibody, Aff - Purified

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Immunogen	Synthetic peptide mapping at the middle region of Human Neurotrophin-3

1 / 2

2 / 2

Previous Next

Neurotrophin 3 (NTF3) (NM_002527) Human Tagged ORF Clone

RC214226L2

USD 620.00

3 Weeks

Lenti ORF clone of Human neurotrophin 3 (NTF3), transcript variant 2, mGFP tagged

Vector	pLenti-C-mGFP
Tag	mGFP
Mammalian Cell Selection	None

• LentiORF^®

Neurotrophin 3 (NTF3) (NM_001102654) Human Tagged ORF Clone

RC214281L2

USD 620.00

3 Weeks

Lenti ORF clone of Human neurotrophin 3 (NTF3), transcript variant 1, mGFP tagged

Vector	pLenti-C-mGFP
Tag	mGFP
Mammalian Cell Selection	None

• LentiORF^®

Neurotrophin 3 (NTF3) Rabbit Polyclonal Antibody

TA328680

USD 585.00

3 Weeks

Rabbit Polyclonal Anti-NT3

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Peptide GEIKTGNSPV(C), corresponding to amino acid residues 39-48 of mature human NT-3 (residues 177-186 of the NT-3 precursor).

1 / 2

2 / 2

Previous Next

Neurotrophin 3 (NTF3) (NM_002527) Human Over-expression Lysate

LC419271

USD 121.00

In Stock

NTF3 HEK293T cell transient overexpression lysate (as WB positive control)

Tag	C-Myc/DDK
Expression Host	HEK293T
Applications	WB

Neurotrophin 3 (NTF3) (NM_001102654) Human Over-expression Lysate

LC420181

USD 121.00

In Stock

NTF3 HEK293T cell transient overexpression lysate (as WB positive control)

Tag	C-Myc/DDK
Expression Host	HEK293T
Applications	WB

Neurotrophin 3 (NTF3) Rabbit Polyclonal Antibody

TA328681

USD 585.00

3 Weeks

Rabbit Polyclonal Anti-proNT-3

Applications	IHC, WB
Reactivities	Mouse, Rat
Conjugation	Unconjugated
Immunogen	Peptide (C)DTELLRQQRRYNSPR, corresponding to amino acid residues 89-103 of human NT-3 (precursor).Pro domain of the NT-3 protein.

1 / 3

2 / 3

3 / 3

Previous Next

Neurotrophin 3 (NTF3) Rabbit Polyclonal Antibody

TA319066

USD 355.00

3 Weeks

Rabbit polyclonal anti-NT-3 antibody

Applications	WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	E. coli-expressed recombinant human NT-3

Neurotrophin 3 (NTF3) Rabbit Polyclonal Antibody

TA342144

USD 375.00

5 Days

Rabbit polyclonal Anti-Ntf3 Antibody

Applications	WB
Reactivities	Rat
Conjugation	Unconjugated
Immunogen	The immunogen for Anti-Ntf3 antibody is: synthetic peptide directed towards the N-terminal region of Ntf3. Synthetic peptide located within the following region: LAYLRGIQGNNMDQRSLPEDSLNSLIIKLIQADILKNKLSKQMVDVKENY

Neurotrophin 3 (NTF3) Mouse Monoclonal Antibody [Clone ID: OTI5A2]

CF500030

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) NT3 mouse monoclonal antibody, clone OTI5A2 (formerly 5A2)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

Neurotrophin 3 (NTF3) Mouse Monoclonal Antibody [Clone ID: OTI2D1]

CF500031

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) NT3 mouse monoclonal antibody, clone OTI2D1 (formerly 2D1)

Applications	WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

Neurotrophin 3 (NTF3) Mouse Monoclonal Antibody [Clone ID: OTI3D4]

CF500032

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) NT3 mouse monoclonal antibody, clone OTI3D4 (formerly 3D4)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

Neurotrophin 3 (NTF3) (NM_002527) Human Over-expression Lysate

LY419271

USD 396.00

5 Days

Transient overexpression lysate of neurotrophin 3 (NTF3), transcript variant 2

Tag	C-Myc/DDK
Expression Host	HEK293T
Applications	WB

Neurotrophin 3 (NTF3) Mouse Monoclonal Antibody [Clone ID: OTI5A2]

TA500030

USD 379.00

In Stock

Anti-NT3 (Neurotrophin 3) mouse monoclonal antibody, clone OTI5A2 (formerly 5A2)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

Neurotrophin 3 (NTF3) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5A2]

TA500030AM

USD 420.00

4 Weeks

Anti-NT3 (Neurotrophin 3) mouse monoclonal antibody, clone OTI5A2 (formerly 5A2), Biotinylated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

Neurotrophin 3 (NTF3) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5A2]

TA500030BM

USD 420.00

4 Weeks

Anti-NT3 (Neurotrophin 3) mouse monoclonal antibody, clone OTI5A2 (formerly 5A2), HRP conjugated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

Neurotrophin 3 (NTF3) Mouse Monoclonal Antibody [Clone ID: OTI5A2]

TA500030S

USD 159.00

In Stock

Anti-NT3 (Neurotrophin 3) mouse monoclonal antibody, clone OTI5A2 (formerly 5A2)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

Neurotrophin 3 (NTF3) Mouse Monoclonal Antibody [Clone ID: OTI2D1]

TA500031

USD 379.00

In Stock

Anti-NT3 (Neurotrophin 3) mouse monoclonal antibody, clone OTI2D1 (formerly 2D1)

Applications	WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

Neurotrophin 3 (NTF3) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2D1]

TA500031AM

USD 420.00

4 Weeks

Anti-NT3 (Neurotrophin 3) mouse monoclonal antibody, clone OTI2D1 (formerly 2D1), Biotinylated

Applications	WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

Neurotrophin 3 (NTF3) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2D1]

TA500031BM

USD 420.00

4 Weeks

Anti-NT3 (Neurotrophin 3) mouse monoclonal antibody, clone OTI2D1 (formerly 2D1), HRP conjugated

Applications	WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

Neurotrophin 3 (NTF3) Mouse Monoclonal Antibody [Clone ID: OTI2D1]

TA500031S

USD 159.00

2 Days

Anti-NT3 (Neurotrophin 3) mouse monoclonal antibody, clone OTI2D1 (formerly 2D1)

Applications	WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

Neurotrophin 3 (NTF3) Mouse Monoclonal Antibody [Clone ID: OTI3D4]

TA500032

USD 379.00

In Stock

NT3 (Neurotrophin 3) mouse monoclonal antibody, clone OTI3D4 (formerly 3D4)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

Neurotrophin 3 (NTF3) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3D4]

TA500032AM

USD 420.00

4 Weeks

NT3 (Neurotrophin 3) mouse monoclonal antibody, clone OTI3D4 (formerly 3D4), Biotinylated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

Neurotrophin 3 (NTF3) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3D4]

TA500032BM

USD 420.00

4 Weeks

NT3 (Neurotrophin 3) mouse monoclonal antibody, clone OTI3D4 (formerly 3D4), HRP conjugated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

Neurotrophin 3 (NTF3) Mouse Monoclonal Antibody [Clone ID: OTI3D4]

TA500032S

USD 159.00

In Stock

NT3 (Neurotrophin 3) mouse monoclonal antibody, clone OTI3D4 (formerly 3D4)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

Neurotrophin 3 (NTF3) Mouse Monoclonal Antibody [Clone ID: OTI5C7]

TA500115

USD 379.00

In Stock

Anti-NT3 (Neurotrophin 3) mouse monoclonal antibody, clone OTI5C7 (formerly 5C7)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 16

2 / 16

3 / 16

4 / 16

5 / 16

6 / 16

7 / 16

8 / 16

9 / 16

10 / 16

11 / 16

12 / 16

13 / 16

14 / 16

15 / 16

16 / 16

Previous Next

Neurotrophin 3 (NTF3) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5C7]

TA500115AM

USD 420.00

4 Weeks

Anti-NT3 (Neurotrophin 3) mouse monoclonal antibody, clone OTI5C7 (formerly 5C7), Biotinylated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

1 / 16

2 / 16

3 / 16

4 / 16

5 / 16

6 / 16

7 / 16

8 / 16

9 / 16

10 / 16

11 / 16

12 / 16

13 / 16

14 / 16

15 / 16

16 / 16

Previous Next

Neurotrophin 3 (NTF3) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5C7]

TA500115BM

USD 420.00

4 Weeks

Anti-NT3 (Neurotrophin 3) mouse monoclonal antibody, clone OTI5C7 (formerly 5C7), HRP conjugated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

1 / 16

2 / 16

3 / 16

4 / 16

5 / 16

6 / 16

7 / 16

8 / 16

9 / 16

10 / 16

11 / 16

12 / 16

13 / 16

14 / 16

15 / 16

16 / 16

Previous Next

Neurotrophin 3 (NTF3) Mouse Monoclonal Antibody [Clone ID: OTI5C7]

TA500115S

USD 159.00

In Stock

Anti-NT3 (Neurotrophin 3) mouse monoclonal antibody, clone OTI5C7 (formerly 5C7)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 16

2 / 16

3 / 16

4 / 16

5 / 16

6 / 16

7 / 16

8 / 16

9 / 16

10 / 16

11 / 16

12 / 16

13 / 16

14 / 16

15 / 16

16 / 16

Previous Next

1 - 50 of 61 results

Page 1 of 2