Products

View as table Download

PDGFA (Myc-DDK-tagged)-Human platelet-derived growth factor alpha polypeptide (PDGFA), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

PDGFA (Myc-DDK-tagged)-Human platelet-derived growth factor alpha polypeptide (PDGFA), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Lenti ORF particles, PDGFA (Myc-DDK tagged) - Human platelet-derived growth factor alpha polypeptide (PDGFA), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®

Lenti ORF particles, PDGFA (mGFP-tagged) - Human platelet-derived growth factor alpha polypeptide (PDGFA), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®

Lenti ORF particles, PDGFA (Myc-DDK tagged) - Human platelet-derived growth factor alpha polypeptide (PDGFA), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®

Lenti ORF particles, PDGFA (mGFP-tagged) - Human platelet-derived growth factor alpha polypeptide (PDGFA), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®

Lenti ORF particles, PDGFA (Myc-DDK tagged) - Human platelet-derived growth factor alpha polypeptide (PDGFA), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human platelet-derived growth factor alpha polypeptide (PDGFA), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, PDGFA (mGFP-tagged) - Human platelet-derived growth factor alpha polypeptide (PDGFA), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human platelet-derived growth factor alpha polypeptide (PDGFA), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, PDGFA (Myc-DDK tagged) - Human platelet-derived growth factor alpha polypeptide (PDGFA), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human platelet-derived growth factor alpha polypeptide (PDGFA), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, PDGFA (mGFP-tagged) - Human platelet-derived growth factor alpha polypeptide (PDGFA), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

PDGFA (GFP-tagged) - Human platelet-derived growth factor alpha polypeptide (PDGFA), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

PDGFA (GFP-tagged) - Human platelet-derived growth factor alpha polypeptide (PDGFA), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

PDGFA (untagged)-Human platelet-derived growth factor alpha polypeptide (PDGFA), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

Purified recombinant protein of Human platelet-derived growth factor alpha polypeptide (PDGFA), transcript variant 1.

Tag Tag Free
Expression Host E. coli

Transient overexpression lysate of platelet-derived growth factor alpha polypeptide (PDGFA), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Special Offer: Get a 20% discount on this product. Use code: "OEL20".

PDGF AA (PDGFA) (PDGF-AA) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, FN, IHC, WB
Reactivities Human
Immunogen Highly pure (>98%) E.coli derived recombinant Human PDGF-AA (Cat.-No PA118).

PDGF AA (PDGFA) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 121-160 of Human PDGF-A.

PDGFA (PDGF-AA) human recombinant protein, 5 µg

Expression Host E. coli

PDGFA (PDGF-AA) human recombinant protein, 2 µg

Expression Host E. coli

PDGFA (PDGF-AA) human recombinant protein, 20 µg

Expression Host E. coli

PDGFA (PDGF-AB) human recombinant protein, 5 µg

Expression Host E. coli

PDGFA (PDGF-AB) human recombinant protein, 2 µg

Expression Host E. coli

PDGFA (PDGF-AB) human recombinant protein, 20 µg

Expression Host E. coli

PDGF AA (PDGFA) (PDGF-AA) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, FN, IHC, WB
Reactivities Human
Immunogen Highly pure (>98%) recombinant hPDGF-AA

Rabbit Polyclonal Anti-PDGFA Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-PDGFA Antibody: A synthesized peptide

PDGF AA (PDGFA) (PDGF-AA) rabbit polyclonal antibody, Biotin

Applications ELISA, WB
Reactivities Human
Conjugation Biotin
Immunogen Highly pure (>98%) E.coli derived recombinant Human PDGF-AA (Cat.-No PA118)

Lenti ORF clone of Human platelet-derived growth factor alpha polypeptide (PDGFA), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

Lenti ORF clone of Human platelet-derived growth factor alpha polypeptide (PDGFA), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

PDGF AA (PDGFA) (PDGF-AA) rabbit polyclonal antibody, Biotin

Applications ELISA, WB
Reactivities Human
Conjugation Biotin
Immunogen Highly pure (>98%) E.coli derived recombinant Human PDGF-AA (Cat.-No PA118)

Anti-Human PDGF-AA Rabbit Polyclonal Antibody

Applications ELISA, IHC
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human PDGF-AA

Purified recombinant protein of Human platelet-derived growth factor alpha polypeptide (PDGFA), transcript variant 2

Tag N-His
Expression Host E. coli

Biotinylated Anti-Human PDGF-AA Rabbit Polyclonal Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human PDGF-AA

Rabbit Polyclonal Anti-PDGFA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PDGFA antibody is: synthetic peptide directed towards the C-terminal region of Human PDGFA. Synthetic peptide located within the following region: HRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATTSLNPDYREEDTDVR

PDGFA HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

PDGFA HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

PDGFA HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Transient overexpression lysate of platelet-derived growth factor alpha polypeptide (PDGFA), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Special Offer: Get a 20% discount on this product. Use code: "OEL20".

LY409784 is the same product as LY429844.

Transient overexpression lysate of platelet-derived growth factor alpha polypeptide (PDGFA), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Special Offer: Get a 20% discount on this product. Use code: "OEL20".

PDGFA MS Standard C13 and N15-labeled recombinant protein (NP_148983)

Tag C-Myc/DDK
Expression Host HEK293

PDGFA (untagged)-Human platelet-derived growth factor alpha polypeptide (PDGFA), transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

Anti-PDGFA Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 101-114 amino acids of Human platelet-derived growth factor alpha polypeptide

Anti-PDGFA Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 101-114 amino acids of Human platelet-derived growth factor alpha polypeptide

Transient overexpression of PDGFA (NM_033023) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of PDGFA (NM_002607) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Purified recombinant protein of Human platelet-derived growth factor alpha polypeptide (PDGFA), transcript variant 2

Tag N-His
Expression Host E. coli

Purified recombinant protein of Human platelet-derived growth factor alpha polypeptide (PDGFA), transcript variant 2

Tag N-His
Expression Host E. coli

Purified recombinant protein of Human platelet-derived growth factor alpha polypeptide (PDGFA), transcript variant 2

Tag N-His
Expression Host E. coli