Germany
Japan
United Kingdom
China
PPM1A (Myc-DDK-tagged)-Human protein phosphatase, Mg2+/Mn2+ dependent, 1A (PPM1A), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
PPM1A (Myc-DDK-tagged)-Human protein phosphatase, Mg2+/Mn2+ dependent, 1A (PPM1A), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Recombinant protein of human protein phosphatase 1A (formerly 2C), magnesium-dependent, alpha isoform (PPM1A), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Lenti ORF particles, PPM1A (Myc-DDK tagged) - Human protein phosphatase, Mg2+/Mn2+ dependent, 1A (PPM1A), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, PPM1A (mGFP-tagged) - Human protein phosphatase, Mg2+/Mn2+ dependent, 1A (PPM1A), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
PPM1A (Myc-DDK-tagged)-Human protein phosphatase, Mg2+/Mn2+ dependent, 1A (PPM1A), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PPM1A (GFP-tagged) - Human protein phosphatase, Mg2+/Mn2+ dependent, 1A (PPM1A), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Recombinant protein of human protein phosphatase 1A (formerly 2C), magnesium-dependent, alpha isoform (PPM1A), transcript variant 3
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Lenti ORF clone of Human protein phosphatase, Mg2+/Mn2+ dependent, 1A (PPM1A), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, PPM1A (Myc-DDK tagged) - Human protein phosphatase, Mg2+/Mn2+ dependent, 1A (PPM1A), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human protein phosphatase, Mg2+/Mn2+ dependent, 1A (PPM1A), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, PPM1A (mGFP-tagged) - Human protein phosphatase, Mg2+/Mn2+ dependent, 1A (PPM1A), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of PPM1A (Myc-DDK-tagged)-Human protein phosphatase, Mg2+/Mn2+ dependent, 1A (PPM1A), transcript variant 2
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, PPM1A (Myc-DDK-tagged)-Human protein phosphatase, Mg2+/Mn2+ dependent, 1A (PPM1A), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of PPM1A (mGFP-tagged)-Human protein phosphatase, Mg2+/Mn2+ dependent, 1A (PPM1A), transcript variant 2
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, PPM1A (mGFP-tagged)-Human protein phosphatase, Mg2+/Mn2+ dependent, 1A (PPM1A), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human protein phosphatase, Mg2+/Mn2+ dependent, 1A (PPM1A), transcript variant 3, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, PPM1A (Myc-DDK tagged) - Human protein phosphatase, Mg2+/Mn2+ dependent, 1A (PPM1A), transcript variant 3, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human protein phosphatase, Mg2+/Mn2+ dependent, 1A (PPM1A), transcript variant 3, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, PPM1A (mGFP-tagged) - Human protein phosphatase, Mg2+/Mn2+ dependent, 1A (PPM1A), transcript variant 3, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
PPM1A (GFP-tagged) - Human protein phosphatase, Mg2+/Mn2+ dependent, 1A (PPM1A), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PPM1A (GFP-tagged) - Human protein phosphatase, Mg2+/Mn2+ dependent, 1A (PPM1A), transcript variant 3
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PPM1A (untagged)-Human protein phosphatase, Mg2+/Mn2+ dependent, 1A (PPM1A), transcript variant 1
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human protein phosphatase, Mg2+/Mn2+ dependent, 1A (PPM1A), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Protein phosphatase 1A / PPM1A (1-382, His-tag) human protein, 0.1 mg
| Tag | His-tag |
| Expression Host | E. coli |
Protein phosphatase 1A / PPM1A (1-382, His-tag) human protein, 0.5 mg
| Tag | His-tag |
| Expression Host | E. coli |
Rabbit Polyclonal Anti-PPM1A Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPM1A antibody: synthetic peptide directed towards the middle region of human PPM1A. Synthetic peptide located within the following region: EIDEHMRVMSEKKHGADRSGSTAVGVLISPQHTYFINCGDSRGLLCRNRK |
Lenti ORF clone of Human protein phosphatase, Mg2+/Mn2+ dependent, 1A (PPM1A), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
PPM1A HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
PPM1A HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of protein phosphatase 1A (formerly 2C), magnesium-dependent, alpha isoform (PPM1A), transcript variant 2
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
PPM1A (untagged)-Human protein phosphatase, Mg2+/Mn2+ dependent, 1A (PPM1A), transcript variant 3
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Transient overexpression lysate of protein phosphatase 1A (formerly 2C), magnesium-dependent, alpha isoform (PPM1A), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
PPM1A MS Standard C13 and N15-labeled recombinant protein (NP_066283)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
PPM1A (untagged)-Human protein phosphatase, Mg2+/Mn2+ dependent, 1A (PPM1A), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
PPM1A (untagged)-Human protein phosphatase 1A (formerly 2C) magnesium-dependent alpha isoform (PPM1A) transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Transient overexpression of PPM1A (NM_021003) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PPM1A (NM_177951) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PPM1A (NM_177952) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Recombinant protein of human protein phosphatase 1A (formerly 2C), magnesium-dependent, alpha isoform (PPM1A), transcript variant 1
| Tag | C-His |
| Expression Host | E. coli |
Recombinant protein of human protein phosphatase 1A (formerly 2C), magnesium-dependent, alpha isoform (PPM1A), transcript variant 1
| Tag | C-His |
| Expression Host | E. coli |
Recombinant protein of human protein phosphatase 1A (formerly 2C), magnesium-dependent, alpha isoform (PPM1A), transcript variant 1
| Tag | C-His |
| Expression Host | E. coli |
Recombinant protein of human protein phosphatase 1A (formerly 2C), magnesium-dependent, alpha isoform (PPM1A), transcript variant 1
| Tag | C-His |
| Expression Host | E. coli |
Transient overexpression of PPM1A (NM_021003) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of PPM1A (NM_021003) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of PPM1A (NM_177951) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of PPM1A (NM_177951) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of PPM1A (NM_177952) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of PPM1A (NM_177952) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- PPM1A
Pathways
- MAPK signaling pathway