Products

View as table Download

PPM1A (Myc-DDK-tagged)-Human protein phosphatase, Mg2+/Mn2+ dependent, 1A (PPM1A), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

PPM1A (Myc-DDK-tagged)-Human protein phosphatase, Mg2+/Mn2+ dependent, 1A (PPM1A), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Recombinant protein of human protein phosphatase 1A (formerly 2C), magnesium-dependent, alpha isoform (PPM1A), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T

Lenti ORF particles, PPM1A (Myc-DDK tagged) - Human protein phosphatase, Mg2+/Mn2+ dependent, 1A (PPM1A), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®

Lenti ORF particles, PPM1A (mGFP-tagged) - Human protein phosphatase, Mg2+/Mn2+ dependent, 1A (PPM1A), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®

Ppm1a (Myc-DDK-tagged) - Mouse protein phosphatase 1A, magnesium dependent, alpha isoform (Ppm1a)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

PPM1A (Myc-DDK-tagged)-Human protein phosphatase, Mg2+/Mn2+ dependent, 1A (PPM1A), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

PPM1A (GFP-tagged) - Human protein phosphatase, Mg2+/Mn2+ dependent, 1A (PPM1A), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Recombinant protein of human protein phosphatase 1A (formerly 2C), magnesium-dependent, alpha isoform (PPM1A), transcript variant 3

Tag C-Myc/DDK
Expression Host HEK293T

PPM1A - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN402070 is the updated version of KN202070.

Ppm1a - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN513708 is the updated version of KN313708.

Ppm1a (GFP-tagged) - Mouse protein phosphatase 1A, magnesium dependent, alpha isoform (Ppm1a)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Ppm1a (Myc-DDK-tagged) - Mouse protein phosphatase 1A, magnesium dependent, alpha isoform (Ppm1a)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Ppm1a (Myc-DDK-tagged) - Mouse protein phosphatase 1A, magnesium dependent, alpha isoform (Ppm1a), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Ppm1a (mGFP-tagged) - Mouse protein phosphatase 1A, magnesium dependent, alpha isoform (Ppm1a)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Ppm1a (GFP-tagged) - Mouse protein phosphatase 1A, magnesium dependent, alpha isoform (Ppm1a), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human protein phosphatase, Mg2+/Mn2+ dependent, 1A (PPM1A), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, PPM1A (Myc-DDK tagged) - Human protein phosphatase, Mg2+/Mn2+ dependent, 1A (PPM1A), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human protein phosphatase, Mg2+/Mn2+ dependent, 1A (PPM1A), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, PPM1A (mGFP-tagged) - Human protein phosphatase, Mg2+/Mn2+ dependent, 1A (PPM1A), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti-ORF clone of PPM1A (Myc-DDK-tagged)-Human protein phosphatase, Mg2+/Mn2+ dependent, 1A (PPM1A), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, PPM1A (Myc-DDK-tagged)-Human protein phosphatase, Mg2+/Mn2+ dependent, 1A (PPM1A), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti-ORF clone of PPM1A (mGFP-tagged)-Human protein phosphatase, Mg2+/Mn2+ dependent, 1A (PPM1A), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, PPM1A (mGFP-tagged)-Human protein phosphatase, Mg2+/Mn2+ dependent, 1A (PPM1A), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human protein phosphatase, Mg2+/Mn2+ dependent, 1A (PPM1A), transcript variant 3, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, PPM1A (Myc-DDK tagged) - Human protein phosphatase, Mg2+/Mn2+ dependent, 1A (PPM1A), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human protein phosphatase, Mg2+/Mn2+ dependent, 1A (PPM1A), transcript variant 3, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, PPM1A (mGFP-tagged) - Human protein phosphatase, Mg2+/Mn2+ dependent, 1A (PPM1A), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

PPM1A (GFP-tagged) - Human protein phosphatase, Mg2+/Mn2+ dependent, 1A (PPM1A), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

PPM1A (GFP-tagged) - Human protein phosphatase, Mg2+/Mn2+ dependent, 1A (PPM1A), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Ppm1a (Myc-DDK-tagged ORF) - Rat protein phosphatase 1A, magnesium dependent, alpha isoform (Ppm1a), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Ppm1a (Myc-DDK-tagged ORF) - Rat protein phosphatase 1A, magnesium dependent, alpha isoform (Ppm1a), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Ppm1a (Myc-DDK-tagged ORF) - Rat protein phosphatase 1A, magnesium dependent, alpha isoform (Ppm1a), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Ppm1a (mGFP-tagged ORF) - Rat protein phosphatase 1A, magnesium dependent, alpha isoform (Ppm1a), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Ppm1a (GFP-tagged ORF) - Rat protein phosphatase 1A, magnesium dependent, alpha isoform (Ppm1a), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

PPM1A (untagged)-Human protein phosphatase, Mg2+/Mn2+ dependent, 1A (PPM1A), transcript variant 1

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin

Lenti ORF clone of Human protein phosphatase, Mg2+/Mn2+ dependent, 1A (PPM1A), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Protein phosphatase 1A / PPM1A (1-382, His-tag) human protein, 0.1 mg

Tag His-tag
Expression Host E. coli

Protein phosphatase 1A / PPM1A (1-382, His-tag) human protein, 0.5 mg

Tag His-tag
Expression Host E. coli

Rabbit Polyclonal Anti-PPM1A Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PPM1A antibody: synthetic peptide directed towards the middle region of human PPM1A. Synthetic peptide located within the following region: EIDEHMRVMSEKKHGADRSGSTAVGVLISPQHTYFINCGDSRGLLCRNRK

PPM1A mouse monoclonal antibody, clone 4E11, Purified

Applications ELISA, IHC, WB
Reactivities Human

Lenti ORF clone of Human protein phosphatase, Mg2+/Mn2+ dependent, 1A (PPM1A), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

PPM1A HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

PPM1A HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Transient overexpression lysate of protein phosphatase 1A (formerly 2C), magnesium-dependent, alpha isoform (PPM1A), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Special Offer: Get a 20% discount on this product. Use code: "OEL20".

Ppm1a (untagged) - Mouse protein phosphatase 1A, magnesium dependent, alpha isoform (Ppm1a), (10ug)

Vector PCMV6-Kan/Neo
Tag Tag Free
Mammalian Cell Selection Neomycin

PPM1A (untagged)-Human protein phosphatase, Mg2+/Mn2+ dependent, 1A (PPM1A), transcript variant 3

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None

qSTAR qPCR primer pairs against Mus musculus gene Ppm1a

PPM1A CRISPRa kit - CRISPR gene activation of human protein phosphatase, Mg2+/Mn2+ dependent 1A

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector

Ppm1a CRISPRa kit - CRISPR gene activation of mouse protein phosphatase 1A, magnesium dependent, alpha isoform

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector