Products

cDNA Clones (10)
Proteins (7)
Antibodies (3)
Jump to Filters
View as table Download
TRP1 (TYRP1) (NM_000550) Human Tagged ORF Clone
RC208595

USD 420.00

In Stock

TYRP1 (Myc-DDK-tagged)-Human tyrosinase-related protein 1 (TYRP1)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
TRP1 (TYRP1) (NM_000550) Human Tagged ORF Clone
RG208595

USD 460.00

In Stock

TYRP1 (GFP-tagged) - Human tyrosinase-related protein 1 (TYRP1)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
TRP1 (TYRP1) (NM_000550) Human Tagged ORF Clone
RC208595L4

USD 620.00

3 Weeks

Lenti ORF clone of Human tyrosinase-related protein 1 (TYRP1), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
TRP1 (TYRP1) (NM_000550) Human Untagged Clone
SC119834

USD 310.00

In Stock

TYRP1 (untagged)-Human tyrosinase-related protein 1 (TYRP1)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
TRP1 (TYRP1) Rabbit Polyclonal Antibody
TA335249

USD 375.00

2 Weeks

Rabbit Polyclonal Anti-TYRP1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-TYRP1 antibody: synthetic peptide directed towards the middle region of human TYRP1. Synthetic peptide located within the following region: NDPIFVLLHTFTDAVFDEWLRRYNADISTFPLENAPIGHNRQYNMVPFWP
TRP1 (TYRP1) (NM_000550) Human Tagged ORF Clone
RC208595L2

USD 620.00

3 Weeks

Lenti ORF clone of Human tyrosinase-related protein 1 (TYRP1), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
TRP1 (TYRP1) (NM_000550) Human Over-expression Lysate
LY400187

USD 396.00

5 Days

Transient overexpression lysate of tyrosinase-related protein 1 (TYRP1)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
TRP1 (TYRP1) Rabbit Polyclonal Antibody
TA335247

USD 310.00

5 Days

Rabbit Polyclonal Anti-TYRP1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-TYRP1 antibody: synthetic peptide directed towards the N terminal of human TYRP1. Synthetic peptide located within the following region: AKRTTHPLFVIATRRSEEILGPDGNTPQFENISIYNYFVWTHYYSVKKTF
TRP1 (TYRP1) Rabbit Polyclonal Antibody
TA335248

USD 375.00

5 Days

Rabbit Polyclonal Anti-Tyrp1 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Tyrp1 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: AHLFLNGTGGQTHLSPNDPIFVLLHTFTDAVFDEWLRRYNADISTFPLEN
TRP1 (TYRP1) (NM_000550) Human Over-expression Lysate
LC400187

USD 121.00

2 Weeks

TYRP1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
TRP1 (TYRP1) (NM_000550) Human Mass Spec Standard
PH308595

USD 2,055.00

3 Weeks

TYRP1 MS Standard C13 and N15-labeled recombinant protein (NP_000541)

Tag C-Myc/DDK
Expression Host HEK293
TRP1 (TYRP1) ICC Control Block
TB408595

USD 1,070.00

4 Weeks

Transient overexpression of TYRP1 (NM_000550) in HEK293T cells paraffin embedded controls for ICC/IHC staining

TRP1 (TYRP1) Cytosection
TS408595

USD 225.00

4 Weeks

Transient overexpression of TYRP1 (NM_000550) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

TRP1 (TYRP1) Cytosection
TS408595P5

USD 889.00

4 Weeks

Transient overexpression of TYRP1 (NM_000550) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack