Recombinant protein of human Fibroblast Growth Factor-basic (FGF2) produced in E. coli
Tag | Tag Free |
Expression Host | E. coli |
Recombinant protein of human Fibroblast Growth Factor-basic (FGF2) produced in E. coli
Tag | Tag Free |
Expression Host | E. coli |
FGF2 (Myc-DDK-tagged)-Human fibroblast growth factor 2 (basic) (FGF2)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
FGF2 (untagged)-Human fibroblast growth factor 2 (basic) (FGF2)
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
FGF2 (GFP-tagged) - Human fibroblast growth factor 2 (basic) (FGF2)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, FGF2 (Myc-DDK tagged) - Human fibroblast growth factor 2 (basic) (FGF2), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, FGF2 (mGFP-tagged) - Human fibroblast growth factor 2 (basic) (FGF2), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Lenti ORF particles, FGF2 (Myc-DDK tagged) - Human fibroblast growth factor 2 (basic) (FGF2), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, FGF2 (mGFP-tagged) - Human fibroblast growth factor 2 (basic) (FGF2), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Purified recombinant protein of Human fibroblast growth factor 2 (basic) (FGF2).
Tag | Tag Free |
Expression Host | E. coli |
Rabbit Polyclonal Anti-FGF2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FGF2 antibody: synthetic peptide directed towards the middle region of human FGF2. Synthetic peptide located within the following region: RLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS |
Lenti ORF clone of Human fibroblast growth factor 2 (basic) (FGF2), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human fibroblast growth factor 2 (basic) (FGF2), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Lenti ORF clone of Human fibroblast growth factor 2 (basic) (FGF2), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Purified recombinant protein of Human fibroblast growth factor 2 (basic) (FGF2)
Tag | Tag Free |
Expression Host | E. coli |
Transient overexpression lysate of fibroblast growth factor 2 (basic) (FGF2)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Lenti ORF clone of Human fibroblast growth factor 2 (basic) (FGF2), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
FGF basic / FGF2 human recombinant protein, 10 µg
Expression Host | E. coli |
FGF basic / FGF2 human recombinant protein, 25 µg
Expression Host | E. coli |
FGF basic / FGF2 human recombinant protein, 50 µg
Expression Host | E. coli |
FGF2 mouse monoclonal antibody, clone F-474, Aff - Purified
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
FGF2 rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | A peptide mapping near the N-terminal of Human FGF2, identical to the related Rat and Mouse sequence |
FGF2 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Anti-Human FGF-basic Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human FGF-basic (154 a.a.) |
FGF2 mouse monoclonal antibody, clone F-343, Aff - Purified
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
FGF2 mouse monoclonal antibody, clone F-3, Aff - Purified
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
FGF2 mouse monoclonal antibody, clone F-74, Aff - Purified
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
FGF2 mouse monoclonal antibody, clone KT1, Aff - Purified
Applications | ELISA |
Reactivities | Human |
FGF2 (Center) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 37-66 amino acids from the Central region of human FGF2 |
FGF2 mouse monoclonal antibody, clone KT1, Aff - Purified
Applications | ELISA |
Reactivities | Human |
FGF2 mouse monoclonal antibody, clone KT1, Aff - Purified
Applications | ELISA |
Reactivities | Human |
Rabbit polyclonal anti-FGF-2 antibody
Applications | WB |
Reactivities | Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | E. coli-expressed recombinant rat FGF-2 |
Biotinylated Anti-Human FGF-basic Rabbit Polyclonal Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human FGF-basic (154 a.a.) |
Carrier-free (BSA/glycerol-free) BFGF mouse monoclonal antibody, clone OTI3D9 (formerly 3D9)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) BFGF mouse monoclonal antibody, clone OTI2H11 (formerly 2H11)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) BFGF mouse monoclonal antibody, clone OTI3D10 (formerly 3D10)
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
FGF2 MS Standard C13 and N15-labeled recombinant protein (NP_001997)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
Anti-FGF2 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 215-229 amino acids of Human Fibroblast growth factor 2 |
bFGF (FGF2) mouse monoclonal antibody, clone OTI3D9 (formerly 3D9)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
bFGF (FGF2) mouse monoclonal antibody, clone OTI3D9 (formerly 3D9), Biotinylated
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
bFGF (FGF2) mouse monoclonal antibody, clone OTI3D9 (formerly 3D9), HRP conjugated
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
bFGF (FGF2) mouse monoclonal antibody, clone OTI3D9 (formerly 3D9)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
bFGF (FGF2) mouse monoclonal antibody, clone OTI2H11 (formerly 2H11)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
bFGF (FGF2) mouse monoclonal antibody, clone OTI2H11 (formerly 2H11), Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
bFGF (FGF2) mouse monoclonal antibody, clone OTI2H11 (formerly 2H11), HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
bFGF (FGF2) mouse monoclonal antibody, clone OTI2H11 (formerly 2H11)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
bFGF (FGF2) mouse monoclonal antibody, clone OTI3D10 (formerly 3D10)
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
bFGF (FGF2) mouse monoclonal antibody, clone OTI3D10 (formerly 3D10), Biotinylated
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
bFGF (FGF2) mouse monoclonal antibody, clone OTI3D10 (formerly 3D10), HRP conjugated
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
bFGF (FGF2) mouse monoclonal antibody, clone OTI3D10 (formerly 3D10)
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit polyclonal anti-FGF2 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human FGF2 |