Products

cDNA Clones (31)
Proteins (25)
Antibodies (20)
Jump to Filters
View as table Download
Argininosuccinate Lyase (ASL) (NM_001024943) Human Tagged ORF Clone Lentiviral Particle
RC201568L3V

USD 820.00

7 Weeks

Lenti ORF particles, ASL (Myc-DDK tagged) - Human argininosuccinate lyase (ASL), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Argininosuccinate Lyase (ASL) (NM_001024943) Human Tagged ORF Clone Lentiviral Particle
RC201568L4V

USD 820.00

7 Weeks

Lenti ORF particles, ASL (mGFP-tagged) - Human argininosuccinate lyase (ASL), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Argininosuccinate Lyase (ASL) (NM_000048) Human Tagged ORF Clone Lentiviral Particle
RC217527L3V

USD 820.00

6 Weeks

Lenti ORF particles, ASL (Myc-DDK tagged) - Human argininosuccinate lyase (ASL), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Argininosuccinate Lyase (ASL) (NM_000048) Human Tagged ORF Clone Lentiviral Particle
RC217527L4V

USD 820.00

6 Weeks

Lenti ORF particles, ASL (mGFP-tagged) - Human argininosuccinate lyase (ASL), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Argininosuccinate Lyase (ASL) (NM_001024944) Human Tagged ORF Clone Lentiviral Particle
RC217587L3V

USD 820.00

6 Weeks

Lenti ORF particles, ASL (Myc-DDK-tagged)-Human argininosuccinate lyase (ASL), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Argininosuccinate Lyase (ASL) (NM_001024944) Human Tagged ORF Clone Lentiviral Particle
RC217587L4V

USD 820.00

6 Weeks

Lenti ORF particles, ASL (mGFP-tagged)-Human argininosuccinate lyase (ASL), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Argininosuccinate Lyase (ASL) (NM_001024946) Human Tagged ORF Clone Lentiviral Particle
RC217708L3V

USD 820.00

6 Weeks

Lenti ORF particles, ASL (Myc-DDK-tagged)-Human argininosuccinate lyase (ASL), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Argininosuccinate Lyase (ASL) (NM_001024946) Human Tagged ORF Clone Lentiviral Particle
RC217708L4V

USD 820.00

6 Weeks

Lenti ORF particles, ASL (mGFP-tagged)-Human argininosuccinate lyase (ASL), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Argininosuccinate Lyase (ASL) (NM_000048) Human Tagged ORF Clone
RG217527

USD 460.00

3 Weeks

ASL (GFP-tagged) - Human argininosuccinate lyase (ASL), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Argininosuccinate Lyase (ASL) (NM_001024943) Human Untagged Clone
SC322186

USD 760.00

In Stock

ASL (untagged)-Human argininosuccinate lyase (ASL), transcript variant 1

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
Argininosuccinate Lyase (ASL) Rabbit Polyclonal Antibody
TA346154

USD 410.00

2 Weeks

Rabbit Polyclonal Anti-ASL Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ASL antibody: synthetic peptide directed towards the middle region of human ASL. Synthetic peptide located within the following region: LILYCTKEFSFVQLSDAYSTGSSLMPQKKNPDSLELIRSKAGRVFGREDK
Argininosuccinate Lyase (ASL) (NM_001024943) Human Over-expression Lysate
LY422562

USD 396.00

In Stock

Transient overexpression lysate of argininosuccinate lyase (ASL), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Argininosuccinate Lyase (ASL) Rabbit Polyclonal Antibody
TA308495

USD 415.00

5 Days

Rabbit polyclonal antibody to Argininosuccinate Lyase (argininosuccinate lyase)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 13 and 261 of ASL (Uniprot ID#P04424)
Argininosuccinate Lyase (ASL) Rabbit Polyclonal Antibody
TA346153

USD 475.00

5 Days

Rabbit Polyclonal Anti-ASL Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ASL antibody: synthetic peptide directed towards the N terminal of human ASL. Synthetic peptide located within the following region: GATAGKLHTGRSRNDQVVTDLRLWMRQTCSTLSGLLWELIRTMVDRAEAE
Argininosuccinate Lyase (ASL) Rabbit Polyclonal Antibody
TA308132

USD 415.00

2 Weeks

Rabbit Polyclonal antibody to ASL (argininosuccinate lyase)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein fragment contain a sequence corresponding to a region within amino acids 86 and 325 of ASL
Argininosuccinate Lyase (ASL) (NM_000048) Human Over-expression Lysate
LC424953

USD 187.00

In Stock

ASL HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Argininosuccinate Lyase (ASL) (NM_001024943) Human Over-expression Lysate
LC422562

USD 121.00

In Stock

ASL HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Argininosuccinate Lyase (ASL) (NM_001024944) Human Over-expression Lysate
LC422563

USD 187.00

In Stock

ASL HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Argininosuccinate Lyase (ASL) (NM_001024946) Human Over-expression Lysate
LC422564

USD 187.00

In Stock

ASL HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Argininosuccinate Lyase (ASL) (NM_001024944) Human Over-expression Lysate
LY422563

USD 605.00

In Stock

Transient overexpression lysate of argininosuccinate lyase (ASL), transcript variant 3

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Argininosuccinate Lyase (ASL) (NM_001024946) Human Over-expression Lysate
LY422564

USD 605.00

In Stock

Transient overexpression lysate of argininosuccinate lyase (ASL), transcript variant 4

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Arginosuccinase (1-464, His-tag) Human Protein
AR50096PU-N

USD 845.00

2 Weeks

Arginosuccinase (1-464, His-tag) human recombinant protein, 0.5 mg

Tag His-tag
Expression Host E. coli
Arginosuccinase (1-464, His-tag) Human Protein
AR50096PU-S

USD 330.00

2 Weeks

Arginosuccinase (1-464, His-tag) human recombinant protein, 0.1 mg

Tag His-tag
Expression Host E. coli
Argininosuccinate Lyase (ASL) Mouse Monoclonal Antibody [Clone ID: OTI3D4]
CF802245

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) ASL mouse monoclonal antibody, clone OTI3D4 (formerly 3D4)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Argininosuccinate Lyase (ASL) Mouse Monoclonal Antibody [Clone ID: OTI9G2]
CF804902

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) ASL mouse monoclonal antibody,clone OTI9G2

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Argininosuccinate Lyase (ASL) (NM_000048) Human Over-expression Lysate
LY424953

USD 605.00

5 Days

Transient overexpression lysate of argininosuccinate lyase (ASL), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Argininosuccinate Lyase (ASL) (NM_000048) Human Mass Spec Standard
PH317527

USD 2,055.00

3 Weeks

ASL MS Standard C13 and N15-labeled recombinant protein (NP_000039)

Tag C-Myc/DDK
Expression Host HEK293
Argininosuccinate Lyase (ASL) (NM_000048) Human Untagged Clone
SC114664

USD 760.00

4 Weeks

ASL (untagged)-Human argininosuccinate lyase (ASL), transcript variant 2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None