Germany
Japan
United Kingdom
China
Recombinant protein of human enolase 1, (alpha) (ENO1)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Products
View as table Download
ENO1 (Myc-DDK-tagged)-Human enolase 1, (alpha) (ENO1), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
ENO1 (untagged)-Human enolase 1, (alpha) (ENO1), transcript variant 1
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
USD 820.00
3 Weeks
Lenti ORF particles, ENO1 (Myc-DDK tagged) - Human enolase 1, (alpha) (ENO1), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
USD 820.00
6 Weeks
Lenti ORF particles, ENO1 (mGFP-tagged) - Human enolase 1, (alpha) (ENO1), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
ENO1 (GFP-tagged) - Human enolase 1, (alpha) (ENO1), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ENO1 (Myc-DDK tagged) - Homo sapiens enolase 1, (alpha) (ENO1), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human enolase 1, (alpha) (ENO1), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
3 Weeks
Lenti ORF particles, ENO1 (Myc-DDK tagged) - Human enolase 1, (alpha) (ENO1), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
USD 820.00
3 Weeks
Lenti ORF particles, ENO1 (mGFP-tagged) - Human enolase 1, (alpha) (ENO1), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
ENO1 (GFP-tagged) - Homo sapiens enolase 1, (alpha) (ENO1), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Rabbit polyclonal ENOA Antibody (N-term)
| Applications | FC, IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This ENOA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 33-60 amino acids from the N-terminal region of human ENOA. |
Alpha-enolase / ENO1 (1-434) human recombinant protein, 0.1 mg
| Expression Host | E. coli |
Lenti ORF clone of Human enolase 1, (alpha) (ENO1), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Non Neuronal Enolase (ENO1) (178-205) rabbit polyclonal antibody, Ig Fraction
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Immunogen | This ENO1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 178-205 amino acids from the Central region of human ENO1. |
Alpha-enolase / ENO1 (1-434) human recombinant protein, 0.5 mg
| Expression Host | E. coli |
USD 385.00
2 Weeks
Non Neuronal Enolase (ENO1) mouse monoclonal antibody, clone NSE-P1, Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Human |
Transient overexpression lysate of enolase 1, (alpha) (ENO1)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit polyclonal ENO1 Antibody (Center)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This ENO1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 178-205 amino acids from the Central region of human ENO1. |
ENO1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Lenti ORF clone of Human enolase 1, (alpha) (ENO1), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
ENO1 (untagged) - Homo sapiens enolase 1, (alpha) (ENO1), transcript variant 2
| Vector | PCMV6-Neo |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
USD 450.00
5 Days
Mouse monoclonal ENO1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-ENO1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ENO1 Antibody: synthetic peptide directed towards the C terminal of human ENO1. Synthetic peptide located within the following region: VVGLCTGQIKTGAPCRSERLAKYNQLLRIEEELGSKAKFAGRNFRNPLAK |
Rabbit Polyclonal Anti-ENO1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ENO1 Antibody: synthetic peptide directed towards the middle region of human ENO1. Synthetic peptide located within the following region: VAASEFFRSGKYDLDFKSPDDPSRYISPDQLADLYKSFIKDYPVVSIEDP |
Rabbit Polyclonal Anti-ENO1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ENO1 antibody: synthetic peptide directed towards the middle region of human ENO1. Synthetic peptide located within the following region: GSGGMTHSDQPKEDRQGVNEKSCNCLLLKVNQIGSVTESLQACKLAQANG |
Rabbit Polyclonal Anti-ENO1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ENO1 antibody: synthetic peptide directed towards the C terminal of human ENO1. Synthetic peptide located within the following region: MSILKIHAREIFDSRGNPTVEVDLFTSKGLFRAAVPSGASTGIYEALELR |
ENO1 MS Standard C13 and N15-labeled recombinant protein (NP_001419)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Rabbit Polyclonal Anti-ENO1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ENO1 |
Transient overexpression of ENO1 (NM_001428) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of ENO1 (NM_001201483) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Purified recombinant protein of Human enolase 1, (alpha) (ENO1), transcript variant 1, 1Met-421Ala, with N-terminal His tag, expressed in E.coli, 50ug
| Tag | N-His |
| Expression Host | E. coli |
Transient overexpression of ENO1 (NM_001428) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of ENO1 (NM_001428) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of ENO1 (NM_001201483) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of ENO1 (NM_001201483) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- ENO1
Pathways
- Metabolic pathways