Germany
Japan
United Kingdom
China
Lenti ORF particles, POLR2A (Myc-DDK tagged) - Human polymerase (RNA) II (DNA directed) polypeptide A, 220kDa (POLR2A), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Products
View as table DownloadPOLR2A (Myc-DDK-tagged)-Human polymerase (RNA) II (DNA directed) polypeptide A, 220kDa (POLR2A)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
POLR2A (GFP-tagged) - Human polymerase (RNA) II (DNA directed) polypeptide A, 220kDa (POLR2A)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human polymerase (RNA) II (DNA directed) polypeptide A, 220kDa (POLR2A), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
POLR2A (untagged)-Human polymerase (RNA) II (DNA directed) polypeptide A, 220kDa (POLR2A)
| Vector | pCMV6-XL6 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit polyclonal POLR2A (Ab-1619) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human POLR2A around the phosphorylation site of serine 1619 (P-T-S-P-S). |
POLR2A (794-822) mouse monoclonal antibody, clone ARNA-3, Supernatant
| Applications | IF, IHC, WB |
| Reactivities | Drosophila, Human |
Rabbit Polyclonal RNA Polymerase II/POLR2A [p Thr4] Antibody
| Applications | Dot, WB |
| Reactivities | Human, Chicken, Drosophila, Yeast |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to a phosphorylated Threonine (position 4) of the CTD heptad in the human RNA polymerase II protein [UniProt P24928] |
Rabbit Polyclonal Anti-POLR2A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-POLR2A antibody is: synthetic peptide directed towards the N-terminal region of Human POLR2A. Synthetic peptide located within the following region: DNKFGVEQPEGDEDLTKEKGHGGCGRYQPRIRRSGLELYAEWKHVNEDSQ |
Mouse monoclonal Anti-RNA polII Clone CTD 4H8
| Reactivities | Human, Saccharomyces cerevisiae |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) POLR2A mouse monoclonal antibody,clone OTI3C8
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
POLR2A mouse monoclonal antibody,clone OTI3C8, Biotinylated
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
POLR2A mouse monoclonal antibody,clone OTI3C8, HRP conjugated
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
Transient overexpression of POLR2A (NM_000937) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of POLR2A (NM_000937) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of POLR2A (NM_000937) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- POLR2A
Pathways
- Metabolic pathways