Products

cDNA Clones (24)
Proteins (9)
Antibodies (1)
Jump to Filters
View as table Download
SMPD4 (NM_017951) Human Tagged ORF Clone
RC219824

USD 970.00

In Stock

SMPD4 (Myc-DDK-tagged)-Human sphingomyelin phosphodiesterase 4, neutral membrane (neutral sphingomyelinase-3) (SMPD4), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
SMPD4 (NM_017951) Human Tagged ORF Clone
RG219824

USD 1,070.00

In Stock

SMPD4 (GFP-tagged) - Human sphingomyelin phosphodiesterase 4, neutral membrane (neutral sphingomyelinase-3) (SMPD4), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
SMPD4 (NM_017751) Human Tagged ORF Clone
RC214161

USD 930.00

4 Weeks

SMPD4 (Myc-DDK-tagged)-Human sphingomyelin phosphodiesterase 4, neutral membrane (neutral sphingomyelinase-3) (SMPD4), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
SMPD4 (NM_017751) Human Tagged ORF Clone
RC214161L3

USD 1,130.00

4 Weeks

Lenti-ORF clone of SMPD4 (Myc-DDK-tagged)-Human sphingomyelin phosphodiesterase 4, neutral membrane (neutral sphingomyelinase-3) (SMPD4), transcript variant 1

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
SMPD4 (NM_017751) Human Tagged ORF Clone Lentiviral Particle
RC214161L3V

USD 1,330.00

7 Weeks

Lenti ORF particles, SMPD4 (Myc-DDK-tagged)-Human sphingomyelin phosphodiesterase 4, neutral membrane (neutral sphingomyelinase-3) (SMPD4), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
SMPD4 (NM_017751) Human Tagged ORF Clone
RC214161L4

USD 1,130.00

4 Weeks

Lenti-ORF clone of SMPD4 (mGFP-tagged)-Human sphingomyelin phosphodiesterase 4, neutral membrane (neutral sphingomyelinase-3) (SMPD4), transcript variant 1

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
SMPD4 (NM_017751) Human Tagged ORF Clone Lentiviral Particle
RC214161L4V

USD 1,330.00

7 Weeks

Lenti ORF particles, SMPD4 (mGFP-tagged)-Human sphingomyelin phosphodiesterase 4, neutral membrane (neutral sphingomyelinase-3) (SMPD4), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
SMPD4 (NM_017951) Human Tagged ORF Clone
RC219824L3

USD 1,170.00

3 Weeks

Lenti ORF clone of Human sphingomyelin phosphodiesterase 4, neutral membrane (neutral sphingomyelinase-3) (SMPD4), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
SMPD4 (NM_017951) Human Tagged ORF Clone Lentiviral Particle
RC219824L3V

USD 1,370.00

6 Weeks

Lenti ORF particles, SMPD4 (Myc-DDK tagged) - Human sphingomyelin phosphodiesterase 4, neutral membrane (neutral sphingomyelinase-3) (SMPD4), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
SMPD4 (NM_017951) Human Tagged ORF Clone
RC219824L4

USD 1,170.00

3 Weeks

Lenti ORF clone of Human sphingomyelin phosphodiesterase 4, neutral membrane (neutral sphingomyelinase-3) (SMPD4), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
SMPD4 (NM_017951) Human Tagged ORF Clone Lentiviral Particle
RC219824L4V

USD 1,370.00

6 Weeks

Lenti ORF particles, SMPD4 (mGFP-tagged) - Human sphingomyelin phosphodiesterase 4, neutral membrane (neutral sphingomyelinase-3) (SMPD4), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
SMPD4 (NM_001171083) Human Tagged ORF Clone
RC230482

USD 850.00

4 Weeks

SMPD4 (Myc-DDK-tagged)-Human sphingomyelin phosphodiesterase 4, neutral membrane (neutral sphingomyelinase-3) (SMPD4), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
SMPD4 (NM_001171083) Human Tagged ORF Clone
RC230482L3

USD 1,050.00

4 Weeks

Lenti-ORF clone of SMPD4 (Myc-DDK-tagged)-Human sphingomyelin phosphodiesterase 4, neutral membrane (neutral sphingomyelinase-3) (SMPD4), transcript variant 3

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
SMPD4 (NM_001171083) Human Tagged ORF Clone Lentiviral Particle
RC230482L3V

USD 1,250.00

7 Weeks

Lenti ORF particles, SMPD4 (Myc-DDK-tagged)-Human sphingomyelin phosphodiesterase 4, neutral membrane (neutral sphingomyelinase-3) (SMPD4), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
SMPD4 (NM_001171083) Human Tagged ORF Clone
RC230482L4

USD 1,050.00

4 Weeks

Lenti-ORF clone of SMPD4 (mGFP-tagged)-Human sphingomyelin phosphodiesterase 4, neutral membrane (neutral sphingomyelinase-3) (SMPD4), transcript variant 3

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
SMPD4 (NM_001171083) Human Tagged ORF Clone Lentiviral Particle
RC230482L4V

USD 1,250.00

7 Weeks

Lenti ORF particles, SMPD4 (mGFP-tagged)-Human sphingomyelin phosphodiesterase 4, neutral membrane (neutral sphingomyelinase-3) (SMPD4), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
SMPD4 (NM_017751) Human Tagged ORF Clone
RG214161

USD 1,020.00

5 Weeks

SMPD4 (GFP-tagged) - Human sphingomyelin phosphodiesterase 4, neutral membrane (neutral sphingomyelinase-3) (SMPD4), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
SMPD4 (NM_001171083) Human Tagged ORF Clone
RG230482

USD 940.00

5 Weeks

SMPD4 (GFP-tagged) - Human sphingomyelin phosphodiesterase 4, neutral membrane (neutral sphingomyelinase-3) (SMPD4), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
SMPD4 (NM_017951) Human Over-expression Lysate
LY413435

USD 605.00

5 Days

Transient overexpression lysate of sphingomyelin phosphodiesterase 4, neutral membrane (neutral sphingomyelinase-3) (SMPD4), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Special Offer: Get a 20% discount on this product. Use code: "OEL20".

SMPD4 (NM_017951) Human Untagged Clone
SC112589

USD 1,760.00

In Stock

SMPD4 (untagged)-Human sphingomyelin phosphodiesterase 4, neutral membrane (neutral sphingomyelinase-3) (SMPD4), transcript variant 2

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
SMPD4 (NM_017751) Human Untagged Clone
SC114022

USD 1,710.00

In Stock

SMPD4 (untagged)-Human sphingomyelin phosphodiesterase 4, neutral membrane (neutral sphingomyelinase-3) (SMPD4), transcript variant 1

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
SMPD4 Rabbit Polyclonal Antibody
TA342050

USD 375.00

5 Days

Rabbit Polyclonal Anti-Smpd4 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Smpd4 antibody is: synthetic peptide directed towards the middle region of Rat Smpd4. Synthetic peptide located within the following region: LHSPAQPSLQALHAYQESFMPTEEHVLVVRLLLKHLHAFANSLKPDQASP
SMPD4 (NM_017951) Human Over-expression Lysate
LC413435

USD 187.00

2 Weeks

SMPD4 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
SMPD4 (AB037839) Human Untagged Clone
SC314837

USD 2,310.00

5 Weeks

(untagged)-Human mRNA for KIAA1418 protein, partial cds

Vector pCMV6 series
Tag Tag Free
SMPD4 (NM_017751) Human Untagged Clone
SC318320

USD 1,710.00

5 Weeks

SMPD4 (untagged)-Human sphingomyelin phosphodiesterase 4, neutral membrane (neutral sphingomyelinase-3) (SMPD4), transcript variant 1

Vector pCMV6 series
Tag Tag Free
SMPD4 (NM_017951) Human Untagged Clone
SC318343

USD 1,760.00

3 Weeks

SMPD4 (untagged)-Human sphingomyelin phosphodiesterase 4, neutral membrane (neutral sphingomyelinase-3) (SMPD4), transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
SMPD4 (NM_001171083) Human Untagged Clone
SC329120

USD 1,560.00

5 Weeks

SMPD4 (untagged)-Human sphingomyelin phosphodiesterase 4 neutral membrane (neutral sphingomyelinase-3) (SMPD4) transcript variant 3

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
SMPD4 (NM_017751) ICC Control Block
TB414161

USD 1,580.00

4 Weeks

Transient overexpression of SMPD4 (NM_017751) in HEK293T cells paraffin embedded controls for ICC/IHC staining

SMPD4 (NM_017951) ICC Control Block
TB419824

USD 1,620.00

4 Weeks

Transient overexpression of SMPD4 (NM_017951) in HEK293T cells paraffin embedded controls for ICC/IHC staining

SMPD4 (NM_001171083) ICC Control Block
TB430482

USD 1,500.00

4 Weeks

Transient overexpression of SMPD4 (NM_001171083) in HEK293T cells paraffin embedded controls for ICC/IHC staining

SMPD4 ICC Control Sections
TS414161P5

USD 889.00

4 Weeks

Transient overexpression of SMPD4 (NM_017751) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

SMPD4 Cytosection
TS419824

USD 225.00

4 Weeks

Transient overexpression of SMPD4 (NM_017951) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

SMPD4 Cytosection
TS419824P5

USD 889.00

4 Weeks

Transient overexpression of SMPD4 (NM_017951) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

SMPD4 ICC Control Sections
TS430482P5

USD 889.00

4 Weeks

Transient overexpression of SMPD4 (NM_001171083) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack