TYR (Myc-DDK-tagged)-Human tyrosinase (oculocutaneous albinism IA) (TYR)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
TYR (Myc-DDK-tagged)-Human tyrosinase (oculocutaneous albinism IA) (TYR)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
TYR (GFP-tagged) - Human tyrosinase (oculocutaneous albinism IA) (TYR)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
USD 880.00
3 Weeks
Lenti ORF particles, TYR (Myc-DDK tagged) - Human tyrosinase (oculocutaneous albinism IA) (TYR), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 880.00
6 Weeks
Lenti ORF particles, TYR (mGFP-tagged) - Human tyrosinase (oculocutaneous albinism IA) (TYR), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Lenti ORF clone of Human tyrosinase (oculocutaneous albinism IA) (TYR), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 880.00
5 Weeks
Lenti ORF particles, TYR (Myc-DDK tagged) - Human tyrosinase (oculocutaneous albinism IA) (TYR), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human tyrosinase (oculocutaneous albinism IA) (TYR), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 880.00
3 Weeks
Lenti ORF particles, TYR (mGFP-tagged) - Human tyrosinase (oculocutaneous albinism IA) (TYR), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
TYR (untagged)-Human tyrosinase (oculocutaneous albinism IA) (cDNA clone MGC:9191 IMAGE:3923096), complete cds
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
TYR (untagged)-Human tyrosinase (oculocutaneous albinism IA) (TYR)
Vector | pCMV6-XL6 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Transient overexpression lysate of tyrosinase (oculocutaneous albinism IA) (TYR)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
TYR Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human TYR |
Tyrosinase (TYR) (C-term) rabbit polyclonal antibody, Purified
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 486-513 amino acids from the C-terminal region of Human Tyrosinase. |
Rabbit Polyclonal Anti-Tyrosinase Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Tyrosinase Antibody: A synthesized peptide derived from human Tyrosinase |
TYR HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Lenti ORF clone of Human tyrosinase (oculocutaneous albinism IA) (TYR), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Rabbit polyclonal Tyrosinase antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human tyrosinase. |
Rabbit Polyclonal Anti-TYR Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TYR antibody: synthetic peptide directed towards the middle region of human TYR. Synthetic peptide located within the following region: CLSLTQYESGSMDKAANFSFRNTLEGFASPLTGIADASQSSMHNALHIYM |
Carrier-free (BSA/glycerol-free) TYR mouse monoclonal antibody, clone OTI1F3 (formerly 1F3)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
TYR MS Standard C13 and N15-labeled recombinant protein (NP_000363)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
Anti-TYR Rabbit Polyclonal Antibody
Applications | ELISA, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 19-319 amino acids of human tyrosinase |
Anti-TYR Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 19-319 amino acids of human tyrosinase |
TYR mouse monoclonal antibody, clone OTI1F3 (formerly 1F3)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
5 Days
TYR mouse monoclonal antibody,clone 1F3, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
5 Days
TYR mouse monoclonal antibody,clone 1F3, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
TYR mouse monoclonal antibody, clone OTI1F3 (formerly 1F3)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Transient overexpression of TYR (NM_000372) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Purified recombinant protein of Human tyrosinase (oculocutaneous albinism IA) (TYR), His19-Phe320, with N-terminal His tag, expressed in E.coli, 50ug
Tag | N-His |
Expression Host | E. coli |
Transient overexpression of TYR (NM_000372) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of TYR (NM_000372) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
TYR (Tyrosinase) mouse monoclonal antibody,clone UMAB257
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TYR (Tyrosinase) mouse monoclonal antibody,clone UMAB257
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
TYR (Tyrosinase) mouse monoclonal antibody,clone UMAB257
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |