RAPGEF1 (Myc-DDK-tagged)-Human Rap guanine nucleotide exchange factor (GEF) 1 (RAPGEF1), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
RAPGEF1 (Myc-DDK-tagged)-Human Rap guanine nucleotide exchange factor (GEF) 1 (RAPGEF1), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
RAPGEF1 (GFP-tagged) - Human Rap guanine nucleotide exchange factor (GEF) 1 (RAPGEF1), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human Rap guanine nucleotide exchange factor (GEF) 1 (RAPGEF1), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 1,550.00
6 Weeks
Lenti ORF particles, RAPGEF1 (Myc-DDK tagged) - Human Rap guanine nucleotide exchange factor (GEF) 1 (RAPGEF1), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human Rap guanine nucleotide exchange factor (GEF) 1 (RAPGEF1), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 1,550.00
6 Weeks
Lenti ORF particles, RAPGEF1 (mGFP-tagged) - Human Rap guanine nucleotide exchange factor (GEF) 1 (RAPGEF1), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
RAPGEF1 (Myc-DDK-tagged)-Human Rap guanine nucleotide exchange factor (GEF) 1 (RAPGEF1), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of RAPGEF1 (Myc-DDK-tagged)-Human Rap guanine nucleotide exchange factor (GEF) 1 (RAPGEF1), transcript variant 1
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 1,530.00
8 Weeks
Lenti ORF particles, RAPGEF1 (Myc-DDK-tagged)-Human Rap guanine nucleotide exchange factor (GEF) 1 (RAPGEF1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of RAPGEF1 (mGFP-tagged)-Human Rap guanine nucleotide exchange factor (GEF) 1 (RAPGEF1), transcript variant 1
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 1,530.00
8 Weeks
Lenti ORF particles, RAPGEF1 (mGFP-tagged)-Human Rap guanine nucleotide exchange factor (GEF) 1 (RAPGEF1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
RAPGEF1 (GFP-tagged) - Human Rap guanine nucleotide exchange factor (GEF) 1 (RAPGEF1), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Transient overexpression lysate of Rap guanine nucleotide exchange factor (GEF) 1 (RAPGEF1), transcript variant 2
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
RAPGEF1 (untagged)-Human Rap guanine nucleotide exchange factor (GEF) 1 (RAPGEF1), transcript variant 2
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
RAPGEF1 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit Polyclonal Anti-RAPGEF1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-RAPGEF1 antibody: synthetic peptide directed towards the C terminal of human RAPGEF1. Synthetic peptide located within the following region: LWAKEQNEEKSPNLTQFTEHFNNMSYWVRSIIMLQEKAQDRERLLLKFIK |
Carrier-free (BSA/glycerol-free) RAPGEF1 mouse monoclonal antibody, clone OTI1F2 (formerly 1F2)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RAPGEF1 mouse monoclonal antibody, clone OTI1B2 (formerly 1B2)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RAPGEF1 mouse monoclonal antibody, clone OTI2F5 (formerly 2F5)
Applications | IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RAPGEF1 mouse monoclonal antibody, clone OTI2C3 (formerly 2C3)
Applications | IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RAPGEF1 mouse monoclonal antibody, clone OTI2B5 (formerly 2B5)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RAPGEF1 mouse monoclonal antibody, clone OTI3H5 (formerly 3H5)
Applications | IF, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
RAPGEF1 (untagged)-Human Rap guanine nucleotide exchange factor (GEF) 1 (RAPGEF1), transcript variant 1
Vector | pCMV6 series |
Tag | Tag Free |
RAPGEF1 mouse monoclonal antibody, clone OTI1F2 (formerly 1F2)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
RAPGEF1 mouse monoclonal antibody, clone OTI1F2 (formerly 1F2)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
RAPGEF1 mouse monoclonal antibody, clone OTI1B2 (formerly 1B2)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
RAPGEF1 mouse monoclonal antibody, clone OTI1B2 (formerly 1B2)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
RAPGEF1 mouse monoclonal antibody, clone OTI2F5 (formerly 2F5)
Applications | IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
RAPGEF1 mouse monoclonal antibody, clone OTI2F5 (formerly 2F5)
Applications | IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
RAPGEF1 mouse monoclonal antibody, clone OTI2C3 (formerly 2C3)
Applications | IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
RAPGEF1 mouse monoclonal antibody, clone OTI2C3 (formerly 2C3)
Applications | IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
RAPGEF1 mouse monoclonal antibody, clone OTI2B5 (formerly 2B5)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
RAPGEF1 mouse monoclonal antibody, clone OTI2B5 (formerly 2B5)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
RAPGEF1 mouse monoclonal antibody, clone OTI3H5 (formerly 3H5)
Applications | IF, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
RAPGEF1 mouse monoclonal antibody, clone OTI3H5 (formerly 3H5), Biotinylated
Applications | IF, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
RAPGEF1 mouse monoclonal antibody, clone OTI3H5 (formerly 3H5), HRP conjugated
Applications | IF, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | HRP |
RAPGEF1 mouse monoclonal antibody, clone OTI3H5 (formerly 3H5)
Applications | IF, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Transient overexpression of RAPGEF1 (NM_198679) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of RAPGEF1 (NM_005312) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of RAPGEF1 (NM_198679) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of RAPGEF1 (NM_198679) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of RAPGEF1 (NM_005312) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
RAPGEF1 mouse monoclonal antibody,clone UMAB140
Applications | 10k-ChIP, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RAPGEF1 mouse monoclonal antibody,clone UMAB140
Applications | 10k-ChIP, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
RAPGEF1 mouse monoclonal antibody,clone UMAB140
Applications | 10k-ChIP, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |