Products

View as table Download

Recombinant protein of human asparagine synthetase (ASNS), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T

Recombinant protein of human asparagine synthetase (ASNS), transcript variant 3

Tag C-Myc/DDK
Expression Host HEK293T

ASNS (GFP-tagged) - Human asparagine synthetase (glutamine-hydrolyzing) (ASNS), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

ASNS (GFP-tagged) - Human asparagine synthetase (glutamine-hydrolyzing) (ASNS), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

ASNS (Myc-DDK-tagged)-Human asparagine synthetase (glutamine-hydrolyzing) (ASNS), transcript variant 5

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

ASNS (Myc-DDK-tagged)-Human asparagine synthetase (glutamine-hydrolyzing) (ASNS), transcript variant 6

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

ASNS (GFP-tagged) - Human asparagine synthetase (glutamine-hydrolyzing) (ASNS), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF particles, ASNS (Myc-DDK tagged) - Human asparagine synthetase (glutamine-hydrolyzing) (ASNS), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human asparagine synthetase (glutamine-hydrolyzing) (ASNS), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, ASNS (mGFP-tagged) - Human asparagine synthetase (glutamine-hydrolyzing) (ASNS), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, ASNS (Myc-DDK tagged) - Human asparagine synthetase (glutamine-hydrolyzing) (ASNS), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human asparagine synthetase (glutamine-hydrolyzing) (ASNS), transcript variant 3, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, ASNS (mGFP-tagged) - Human asparagine synthetase (glutamine-hydrolyzing) (ASNS), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, ASNS (Myc-DDK tagged) - Human asparagine synthetase (glutamine-hydrolyzing) (ASNS), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, ASNS (mGFP-tagged) - Human asparagine synthetase (glutamine-hydrolyzing) (ASNS), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, ASNS (Myc-DDK-tagged)-Human asparagine synthetase (glutamine-hydrolyzing) (ASNS), transcript variant 5, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, ASNS (mGFP-tagged)-Human asparagine synthetase (glutamine-hydrolyzing) (ASNS), transcript variant 5, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, ASNS (Myc-DDK-tagged)-Human asparagine synthetase (glutamine-hydrolyzing) (ASNS), transcript variant 6, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, ASNS (mGFP-tagged)-Human asparagine synthetase (glutamine-hydrolyzing) (ASNS), transcript variant 6, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

ASNS (Myc-DDK-tagged)-Human asparagine synthetase (glutamine-hydrolyzing) (ASNS), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF particles, ASNS (Myc-DDK-tagged)-Human asparagine synthetase (glutamine-hydrolyzing) (ASNS), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, ASNS (mGFP-tagged)-Human asparagine synthetase (glutamine-hydrolyzing) (ASNS), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

ASNS (GFP-tagged) - Human asparagine synthetase (glutamine-hydrolyzing) (ASNS), transcript variant 5

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

ASNS (GFP-tagged) - Human asparagine synthetase (glutamine-hydrolyzing) (ASNS), transcript variant 6

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

ASNS (GFP-tagged) - Human asparagine synthetase (glutamine-hydrolyzing) (ASNS), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Rabbit anti-ASNS Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ASNS

ASNS (untagged)-Human asparagine synthetase (glutamine-hydrolyzing) (ASNS), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

ASNS HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Lenti ORF clone of Human asparagine synthetase (glutamine-hydrolyzing) (ASNS), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

ASNS (untagged)-Human asparagine synthetase (glutamine-hydrolyzing) (ASNS), transcript variant 2

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin

ASNS (untagged)-Human asparagine synthetase (glutamine-hydrolyzing) (ASNS), transcript variant 3

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin

Rabbit Polyclonal Anti-ASNS Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-ASNS antibody: synthetic peptide directed towards the C terminal of human ASNS. Synthetic peptide located within the following region: SVVIFSGEGSDELTQGYIYFHKAPSPEKAEEESERLLRELYLFDVLRADR

Carrier-free (BSA/glycerol-free) ASNS mouse monoclonal antibody, clone OTI1B2 (formerly 1B2)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated