Products

cDNA Clones (20)
Antibodies (18)
Proteins (13)
Jump to Filters
View as table Download
GLS2 (NM_013267) Human Tagged ORF Clone
RC212650

USD 550.00

In Stock

GLS2 (Myc-DDK-tagged)-Human glutaminase 2 (liver, mitochondrial) (GLS2), nuclear gene encoding mitochondrial protein

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
GLS2 (NM_013267) Human Tagged ORF Clone
RG212650

USD 600.00

In Stock

GLS2 (GFP-tagged) - Human glutaminase 2 (liver, mitochondrial) (GLS2), nuclear gene encoding mitochondrial protein

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
GLS2 (NM_013267) Human Tagged ORF Clone Lentiviral Particle
RC212650L1V

USD 950.00

3 Weeks

Lenti ORF particles, GLS2 (Myc-DDK tagged) - Human glutaminase 2 (liver, mitochondrial) (GLS2), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
GLS2 (NM_013267) Human Tagged ORF Clone Lentiviral Particle
RC212650L2V

USD 950.00

6 Weeks

Lenti ORF particles, GLS2 (mGFP-tagged) - Human glutaminase 2 (liver, mitochondrial) (GLS2), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
GLS2 (NM_013267) Human Tagged ORF Clone
RC212650L3

USD 750.00

3 Weeks

Lenti ORF clone of Human glutaminase 2 (liver, mitochondrial) (GLS2), nuclear gene encoding mitochondrial protein, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
GLS2 (NM_013267) Human Tagged ORF Clone Lentiviral Particle
RC212650L3V

USD 950.00

5 Weeks

Lenti ORF particles, GLS2 (Myc-DDK tagged) - Human glutaminase 2 (liver, mitochondrial) (GLS2), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
GLS2 (NM_013267) Human Tagged ORF Clone
RC212650L4

USD 750.00

3 Weeks

Lenti ORF clone of Human glutaminase 2 (liver, mitochondrial) (GLS2), nuclear gene encoding mitochondrial protein, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GLS2 (NM_013267) Human Tagged ORF Clone Lentiviral Particle
RC212650L4V

USD 950.00

7 Weeks

Lenti ORF particles, GLS2 (mGFP-tagged) - Human glutaminase 2 (liver, mitochondrial) (GLS2), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GLS2 (NM_001280796) Human Tagged ORF Clone
RC237458

USD 420.00

2 Weeks

GLS2 (myc-DDK-tagged) - Human glutaminase 2 (liver, mitochondrial) (GLS2), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
GLS2 (NM_001280797) Human Tagged ORF Clone
RC237541

USD 420.00

2 Weeks

GLS2 (myc-DDK-tagged) - Human glutaminase 2 (liver, mitochondrial) (GLS2), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
GLS2 (NM_001280798) Human Tagged ORF Clone
RC237542

USD 420.00

2 Weeks

GLS2 (myc-DDK-tagged) - Human glutaminase 2 (liver, mitochondrial) (GLS2), transcript variant 5

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
GLS2 (NM_013267) Human Tagged Lenti ORF Clone
RC212650L1

USD 924.00

In Stock

Lenti ORF clone of Human glutaminase 2 (liver, mitochondrial) (GLS2), nuclear gene encoding mitochondrial protein, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
GLS2 (NM_013267) Human Recombinant Protein
TP760217

USD 215.00

In Stock

Recombinant protein of human glutaminase 2 (liver, mitochondrial) (GLS2), nuclear gene encoding mitochondrial protein, with N-terminal HIS tag, expressed in E.Coli, 50ug

Tag N-His
Expression Host E. coli
GLS2 (NM_013267) Human Over-expression Lysate
LY415701

USD 605.00

In Stock

Transient overexpression lysate of glutaminase 2 (liver, mitochondrial) (GLS2), nuclear gene encoding mitochondrial protein

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Special Offer: Get a 20% discount on this product. Use code: "OEL20".

GLS2 (NM_013267) Human Untagged Clone
SC111793

USD 1,020.00

In Stock

GLS2 (untagged)-Human glutaminase 2 (liver, mitochondrial) (GLS2), nuclear gene encoding mitochondrial protein

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
GLS2 Rabbit Polyclonal Antibody
TA319893

USD 430.00

2 Weeks

Rabbit Polyclonal GLS2 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen GLS2 antibody was raised against a 18 amino acid synthetic peptide near the center terminus of human GLS2.
GLS2 Rabbit Polyclonal Antibody
TA336821

USD 479.00

5 Days

Rabbit Polyclonal GLS2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Antibody was raised against a 18 amino acid peptide near the center terminus of human GLS2 (NP_037399).
GLS2 (NM_013267) Human Tagged ORF Clone
RC212650L2

USD 750.00

3 Weeks

Lenti ORF clone of Human glutaminase 2 (liver, mitochondrial) (GLS2), nuclear gene encoding mitochondrial protein, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
GLS2 Rabbit Polyclonal Antibody
TA331991

USD 310.00

5 Days

Rabbit Polyclonal Anti-GLS2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-GLS2 Antibody: synthetic peptide directed towards the middle region of human GLS2. Synthetic peptide located within the following region: FVGKEPSGLRYNKLSLNEEGIPHNPMVNAGAIVVSSLIKMDCNKAEKFDF
GLS2 (NM_013267) Human Recombinant Protein
TP760666

USD 215.00

In Stock

Purified recombinant protein of Human glutaminase 2 (liver, mitochondrial) (GLS2), nuclear gene encoding mitochondrial protein, with N-terminal HIS tag, expressed in E.Coli, 50ug

Tag N-His
Expression Host E. coli
GLS2 (NM_013267) Human Over-expression Lysate
LC415701

USD 187.00

In Stock

GLS2 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
GLS2 Mouse Monoclonal Antibody [Clone ID: OTI1C12]
CF809492

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) GLS2 mouse monoclonal antibody,clone OTI1C12

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
GLS2 Mouse Monoclonal Antibody [Clone ID: OTI4C10]
CF809494

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) GLS2 mouse monoclonal antibody,clone OTI4C10

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
GLS2 Mouse Monoclonal Antibody [Clone ID: OTI6D11]
CF809506

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) GLS2 mouse monoclonal antibody,clone OTI6D11

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
GLS2 (NM_001280796) Human Tagged ORF Clone
RG237458

USD 460.00

2 Weeks

GLS2 (GFP-tagged) - Human glutaminase 2 (liver, mitochondrial) (GLS2), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
GLS2 (NM_001280797) Human Tagged ORF Clone
RG237541

USD 460.00

2 Weeks

GLS2 (GFP-tagged) - Human glutaminase 2 (liver, mitochondrial) (GLS2), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
GLS2 (NM_001280798) Human Tagged ORF Clone
RG237542

USD 460.00

2 Weeks

GLS2 (GFP-tagged) - Human glutaminase 2 (liver, mitochondrial) (GLS2), transcript variant 5

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
GLS2 (NM_001280796) Human Untagged Clone
SC335352

USD 330.00

2 Weeks

GLS2 (untagged) - Human glutaminase 2 (liver, mitochondrial) (GLS2), transcript variant 3

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
GLS2 (NM_001280797) Human Untagged Clone
SC335435

USD 340.00

2 Weeks

GLS2 (untagged) - Human glutaminase 2 (liver, mitochondrial) (GLS2), transcript variant 4

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
GLS2 (NM_001280798) Human Untagged Clone
SC335436

USD 340.00

2 Weeks

GLS2 (untagged) - Human glutaminase 2 (liver, mitochondrial) (GLS2), transcript variant 5

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
GLS2 Mouse Monoclonal Antibody [Clone ID: OTI1C12]
TA809492

USD 379.00

In Stock

GLS2 mouse monoclonal antibody,clone OTI1C12

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
GLS2 Mouse Monoclonal Antibody [Clone ID: OTI1C12]
TA809492S

USD 159.00

2 Days

GLS2 mouse monoclonal antibody,clone OTI1C12

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
GLS2 Mouse Monoclonal Antibody [Clone ID: OTI4C10]
TA809494

USD 379.00

In Stock

GLS2 mouse monoclonal antibody,clone OTI4C10

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
GLS2 Mouse Monoclonal Antibody [Clone ID: OTI4C10]
TA809494S

USD 159.00

2 Days

GLS2 mouse monoclonal antibody,clone OTI4C10

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
GLS2 Mouse Monoclonal Antibody [Clone ID: OTI6D11]
TA809506

USD 379.00

In Stock

GLS2 mouse monoclonal antibody,clone OTI6D11

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
GLS2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6D11]
TA809506AM

USD 420.00

4 Weeks

GLS2 mouse monoclonal antibody,clone OTI6D11, Biotinylated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Biotin
GLS2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI6D11]
TA809506BM

USD 420.00

4 Weeks

GLS2 mouse monoclonal antibody,clone OTI6D11, HRP conjugated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation HRP
GLS2 Mouse Monoclonal Antibody [Clone ID: OTI6D11]
TA809506S

USD 159.00

2 Days

GLS2 mouse monoclonal antibody,clone OTI6D11

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
GLS2 (NM_013267) ICC Control Block
TB412650

USD 1,200.00

4 Weeks

Transient overexpression of GLS2 (NM_013267) in HEK293T cells paraffin embedded controls for ICC/IHC staining

GLS2 (NM_001280796) ICC Control Block
TB437458

USD 1,070.00

4 Weeks

Transient overexpression of GLS2 (NM_001280796) in HEK293T cells paraffin embedded controls for ICC/IHC staining

GLS2 (NM_001280797) ICC Control Block
TB437541

USD 1,070.00

4 Weeks

Transient overexpression of GLS2 (NM_001280797) in HEK293T cells paraffin embedded controls for ICC/IHC staining

GLS2 (NM_001280798) ICC Control Block
TB437542

USD 1,070.00

4 Weeks

Transient overexpression of GLS2 (NM_001280798) in HEK293T cells paraffin embedded controls for ICC/IHC staining

GLS2 Cytosection
TS412650

USD 225.00

4 Weeks

Transient overexpression of GLS2 (NM_013267) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

GLS2 Cytosection
TS412650P5

USD 889.00

4 Weeks

Transient overexpression of GLS2 (NM_013267) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

GLS2 ICC Control Sections
TS437458P5

USD 889.00

4 Weeks

Transient overexpression of GLS2 (NM_001280796) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

GLS2 ICC Control Sections
TS437541P5

USD 889.00

4 Weeks

Transient overexpression of GLS2 (NM_001280797) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack