CTBP1 (Myc-DDK-tagged)-Human C-terminal binding protein 1 (CTBP1), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CTBP1 (Myc-DDK-tagged)-Human C-terminal binding protein 1 (CTBP1), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CTBP1 (Myc-DDK-tagged)-Human C-terminal binding protein 1 (CTBP1), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human C-terminal binding protein 1 (CTBP1), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
CTBP1 (GFP-tagged) - Human C-terminal binding protein 1 (CTBP1), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, CTBP1 (Myc-DDK tagged) - Human C-terminal binding protein 1 (CTBP1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, CTBP1 (mGFP-tagged) - Human C-terminal binding protein 1 (CTBP1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Recombinant protein of human C-terminal binding protein 1 (CTBP1), transcript variant 2
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
CTBP1 (GFP-tagged) - Human C-terminal binding protein 1 (CTBP1), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human C-terminal binding protein 1 (CTBP1), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CTBP1 (Myc-DDK tagged) - Human C-terminal binding protein 1 (CTBP1), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human C-terminal binding protein 1 (CTBP1), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CTBP1 (mGFP-tagged) - Human C-terminal binding protein 1 (CTBP1), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CTBP1 (Myc-DDK tagged) - Human C-terminal binding protein 1 (CTBP1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human C-terminal binding protein 1 (CTBP1), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CTBP1 (mGFP-tagged) - Human C-terminal binding protein 1 (CTBP1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human C-terminal binding protein 1 (CTBP1), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human C-terminal binding protein 1 (CTBP1), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
CTBP1 (untagged)-Human C-terminal binding protein 1 (CTBP1), transcript variant 1
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
CTBP1 (untagged)-Human C-terminal binding protein 1 (CTBP1), transcript variant 2
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
CTBP1 mouse monoclonal antibody, clone AT4D6, Purified
Applications | ELISA, FC, IF, WB |
Reactivities | Human |
CTBP1 mouse monoclonal antibody, clone AT4D6, Purified
Applications | ELISA, FC, IF, WB |
Reactivities | Human |
CTBP1 rabbit polyclonal antibody, Aff - Purified
Applications | IF, IP, WB |
Reactivities | Human, Mouse |
Immunogen | Bacterially expressed recombinant human CtBP1. |
Rabbit polyclonal CtBP1 (Ab-422) antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human CtBP1 around the phosphorylation site of serine 422 (A-P-SP-P-G). |
Rabbit polyclonal CtBP1 (Ser422) antibody(Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human CtBP1 around the phosphorylation site of serine 422 (A-P-SP-P-G). |
Modifications | Phospho-specific |
Rabbit anti-CTBP1 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CTBP1 |
Rabbit Polyclonal Anti-CtBP1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CtBP1 Antibody: A synthesized peptide derived from human CtBP1 |
Rabbit Polyclonal Anti-Phospho-CtBP1(Ser422) Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Phospho-CtBP1(Ser422) Antibody: A synthesized peptide derived from human CtBP1 around the phosphorylation site of Sersine 422 |
Modifications | Phospho-specific |
Lenti ORF clone of Human C-terminal binding protein 1 (CTBP1), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Rabbit polyclonal CTBP1 Antibody (C-term)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | This CTBP1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 413-440 amino acids from the C-terminal region of human CTBP1. |
CTBP1 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit polyclonal antibody to CtBP1 (C-terminal binding protein 1)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 194 and 379 of CtBP1 (Uniprot ID#Q13363) |
Rabbit Polyclonal Anti-CTBP1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CTBP1 antibody: synthetic peptide directed towards the C terminal of human CTBP1. Synthetic peptide located within the following region: TGIPAAVEGIVPSAMSLSHGLPPVAHPPHAPSPGQTVKPEADRDHASDQL |
CTBP1 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 412-442 amino acids from the C-terminal region of human CTBP1 |
Rabbit Polyclonal Anti-CTBP1 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CTBP1 antibody: synthetic peptide directed towards the C terminal of human CTBP1. Synthetic peptide located within the following region: TGIPAAVEGIVPSAMSLSHGLPPVAHPPHAPSPGQTVKPEADRDHASDQL |
Rabbit Polyclonal Anti-CTBP1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CTBP1 antibody: synthetic peptide directed towards the N terminal of human CTBP1. Synthetic peptide located within the following region: TREDLEKFKALRIIVRIGSGFDNIDIKSAGDLGIAVCNVPAASVEETADS |
CTBP1 (1-440) human recombinant protein, 0.5 mg
Expression Host | E. coli |
CTBP1 (1-440) human recombinant protein, 0.1 mg
Expression Host | E. coli |
CTBP1 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Transient overexpression lysate of C-terminal binding protein 1 (CTBP1), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of C-terminal binding protein 1 (CTBP1), transcript variant 2
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
CTBP1 MS Standard C13 and N15-labeled recombinant protein (NP_001012632)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
CTBP1 MS Standard C13 and N15-labeled recombinant protein (NP_001319)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
Rabbit Polyclonal Anti-CTBP1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CTBP1 |
Rabbit Polyclonal Anti-CTBP1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CTBP1 |
Transient overexpression of CTBP1 (NM_001012614) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CTBP1 (NM_001328) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CTBP1 (NM_001012614) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CTBP1 (NM_001012614) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of CTBP1 (NM_001328) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CTBP1 (NM_001328) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack