Products

cDNA Clones (22)
Proteins (12)
Antibodies (3)
Jump to Filters
View as table Download
Tbp7 (PSMC4) (NM_006503) Human Tagged ORF Clone
RC204932

USD 420.00

In Stock

PSMC4 (Myc-DDK-tagged)-Human proteasome (prosome, macropain) 26S subunit, ATPase, 4 (PSMC4), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Tbp7 (PSMC4) (NM_153001) Human Tagged ORF Clone
RC203161

USD 420.00

In Stock

PSMC4 (Myc-DDK-tagged)-Human proteasome (prosome, macropain) 26S subunit, ATPase, 4 (PSMC4), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Tbp7 (PSMC4) (NM_153001) Human Tagged ORF Clone Lentiviral Particle
RC203161L1V

USD 820.00

3 Weeks

Lenti ORF particles, PSMC4 (Myc-DDK tagged) - Human proteasome (prosome, macropain) 26S subunit, ATPase, 4 (PSMC4), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
Tbp7 (PSMC4) (NM_153001) Human Tagged ORF Clone Lentiviral Particle
RC203161L2V

USD 820.00

6 Weeks

Lenti ORF particles, PSMC4 (mGFP-tagged) - Human proteasome (prosome, macropain) 26S subunit, ATPase, 4 (PSMC4), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
Tbp7 (PSMC4) (NM_006503) Human Tagged ORF Clone Lentiviral Particle
RC204932L1V

USD 820.00

3 Weeks

Lenti ORF particles, PSMC4 (Myc-DDK tagged) - Human proteasome (prosome, macropain) 26S subunit, ATPase, 4 (PSMC4), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
Tbp7 (PSMC4) (NM_006503) Human Tagged ORF Clone Lentiviral Particle
RC204932L2V

USD 820.00

6 Weeks

Lenti ORF particles, PSMC4 (mGFP-tagged) - Human proteasome (prosome, macropain) 26S subunit, ATPase, 4 (PSMC4), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
Tbp7 (PSMC4) (NM_153001) Human Tagged ORF Clone
RG203161

USD 460.00

In Stock

PSMC4 (GFP-tagged) - Human proteasome (prosome, macropain) 26S subunit, ATPase, 4 (PSMC4), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Tbp7 (PSMC4) (NM_006503) Human Tagged ORF Clone
RG204932

USD 460.00

In Stock

PSMC4 (GFP-tagged) - Human proteasome (prosome, macropain) 26S subunit, ATPase, 4 (PSMC4), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Tbp7 (PSMC4) (NM_153001) Human Tagged ORF Clone
RC203161L3

USD 620.00

3 Weeks

Lenti ORF clone of Human proteasome (prosome, macropain) 26S subunit, ATPase, 4 (PSMC4), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Tbp7 (PSMC4) (NM_153001) Human Tagged ORF Clone Lentiviral Particle
RC203161L3V

USD 820.00

5 Weeks

Lenti ORF particles, PSMC4 (Myc-DDK tagged) - Human proteasome (prosome, macropain) 26S subunit, ATPase, 4 (PSMC4), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Tbp7 (PSMC4) (NM_153001) Human Tagged ORF Clone
RC203161L4

USD 620.00

3 Weeks

Lenti ORF clone of Human proteasome (prosome, macropain) 26S subunit, ATPase, 4 (PSMC4), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Tbp7 (PSMC4) (NM_153001) Human Tagged ORF Clone Lentiviral Particle
RC203161L4V

USD 820.00

7 Weeks

Lenti ORF particles, PSMC4 (mGFP-tagged) - Human proteasome (prosome, macropain) 26S subunit, ATPase, 4 (PSMC4), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Tbp7 (PSMC4) (NM_006503) Human Tagged ORF Clone
RC204932L3

USD 620.00

3 Weeks

Lenti ORF clone of Human proteasome (prosome, macropain) 26S subunit, ATPase, 4 (PSMC4), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Tbp7 (PSMC4) (NM_006503) Human Tagged ORF Clone Lentiviral Particle
RC204932L3V

USD 820.00

5 Weeks

Lenti ORF particles, PSMC4 (Myc-DDK tagged) - Human proteasome (prosome, macropain) 26S subunit, ATPase, 4 (PSMC4), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Tbp7 (PSMC4) (NM_006503) Human Tagged ORF Clone
RC204932L4

USD 620.00

3 Weeks

Lenti ORF clone of Human proteasome (prosome, macropain) 26S subunit, ATPase, 4 (PSMC4), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Tbp7 (PSMC4) (NM_006503) Human Tagged ORF Clone Lentiviral Particle
RC204932L4V

USD 820.00

7 Weeks

Lenti ORF particles, PSMC4 (mGFP-tagged) - Human proteasome (prosome, macropain) 26S subunit, ATPase, 4 (PSMC4), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Tbp7 (PSMC4) (NM_006503) Human Tagged ORF Clone
RC204932L1

USD 768.00

In Stock

Lenti ORF clone of Human proteasome (prosome, macropain) 26S subunit, ATPase, 4 (PSMC4), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
Tbp7 (PSMC4) Rabbit Polyclonal Antibody
TA332530

USD 275.00

3 Weeks

Rabbit anti-PSMC4 Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PSMC4
Tbp7 (PSMC4) Rabbit Polyclonal Antibody
TA345132

USD 475.00

5 Days

Rabbit Polyclonal Anti-PSMC4 Antibody - N-terminal region

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-PSMC4 antibody: synthetic peptide directed towards the N terminal of human PSMC4. Synthetic peptide located within the following region: MEEIGILVEKAQDEIPALSVSRPQTGLSFLGPEPEDLEDLYSRYKKLQQE
Tbp7 (PSMC4) (NM_153001) Human Tagged ORF Clone
RC203161L1

USD 620.00

In Stock

Lenti ORF clone of Human proteasome (prosome, macropain) 26S subunit, ATPase, 4 (PSMC4), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
Tbp7 (PSMC4) Rabbit Polyclonal Antibody
TA345133

USD 475.00

5 Days

Rabbit Polyclonal Anti-PSMC4 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PSMC4 antibody: synthetic peptide directed towards the N terminal of human PSMC4. Synthetic peptide located within the following region: MEEIGILVEKAQDEIPALSVSRPQTGLSFLGPEPEDLEDLYSRYKKLQQE
Tbp7 (PSMC4) (NM_153001) Human Tagged ORF Clone
RC203161L2

USD 620.00

3 Weeks

Lenti ORF clone of Human proteasome (prosome, macropain) 26S subunit, ATPase, 4 (PSMC4), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
Tbp7 (PSMC4) (NM_006503) Human Tagged ORF Clone
RC204932L2

USD 620.00

3 Weeks

Lenti ORF clone of Human proteasome (prosome, macropain) 26S subunit, ATPase, 4 (PSMC4), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
Tbp7 (PSMC4) (NM_006503) Human Untagged Clone
SC319607

USD 310.00

In Stock

PSMC4 (untagged)-Human proteasome (prosome, macropain) 26S subunit, ATPase, 4 (PSMC4), transcript variant 1

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
Tbp7 (PSMC4) (NM_006503) Human Over-expression Lysate
LY401949

USD 396.00

5 Days

Transient overexpression lysate of proteasome (prosome, macropain) 26S subunit, ATPase, 4 (PSMC4), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Tbp7 (PSMC4) (NM_006503) Human Over-expression Lysate
LC401949

USD 121.00

2 Weeks

PSMC4 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Tbp7 (PSMC4) (NM_153001) Human Over-expression Lysate
LC407188

USD 121.00

2 Weeks

PSMC4 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Tbp7 (PSMC4) (NM_153001) Human Over-expression Lysate
LY407188

USD 396.00

5 Days

Transient overexpression lysate of proteasome (prosome, macropain) 26S subunit, ATPase, 4 (PSMC4), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Tbp7 (PSMC4) (NM_006503) Human Mass Spec Standard
PH304932

USD 2,055.00

3 Weeks

PSMC4 MS Standard C13 and N15-labeled recombinant protein (NP_006494)

Tag C-Myc/DDK
Expression Host HEK293
Tbp7 (PSMC4) (NM_153001) Human Untagged Clone
SC109643

USD 760.00

4 Weeks

PSMC4 (untagged)-Human proteasome (prosome, macropain) 26S subunit, ATPase, 4 (PSMC4), transcript variant 2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
Tbp7 (PSMC4) ICC Control Block
TB403161

USD 1,070.00

4 Weeks

Transient overexpression of PSMC4 (NM_153001) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Tbp7 (PSMC4) ICC Control Block
TB404932

USD 1,070.00

4 Weeks

Transient overexpression of PSMC4 (NM_006503) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Tbp7 (PSMC4) Cytosection
TS403161

USD 225.00

4 Weeks

Transient overexpression of PSMC4 (NM_153001) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Tbp7 (PSMC4) Cytosection
TS403161P5

USD 889.00

4 Weeks

Transient overexpression of PSMC4 (NM_153001) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Tbp7 (PSMC4) Cytosection
TS404932

USD 225.00

4 Weeks

Transient overexpression of PSMC4 (NM_006503) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Tbp7 (PSMC4) Cytosection
TS404932P5

USD 889.00

4 Weeks

Transient overexpression of PSMC4 (NM_006503) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack