PSMC4 (Myc-DDK-tagged)-Human proteasome (prosome, macropain) 26S subunit, ATPase, 4 (PSMC4), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PSMC4 (Myc-DDK-tagged)-Human proteasome (prosome, macropain) 26S subunit, ATPase, 4 (PSMC4), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PSMC4 (Myc-DDK-tagged)-Human proteasome (prosome, macropain) 26S subunit, ATPase, 4 (PSMC4), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, PSMC4 (Myc-DDK tagged) - Human proteasome (prosome, macropain) 26S subunit, ATPase, 4 (PSMC4), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, PSMC4 (mGFP-tagged) - Human proteasome (prosome, macropain) 26S subunit, ATPase, 4 (PSMC4), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Lenti ORF particles, PSMC4 (Myc-DDK tagged) - Human proteasome (prosome, macropain) 26S subunit, ATPase, 4 (PSMC4), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, PSMC4 (mGFP-tagged) - Human proteasome (prosome, macropain) 26S subunit, ATPase, 4 (PSMC4), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Recombinant protein of human proteasome (prosome, macropain) 26S subunit, ATPase, 4 (PSMC4), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
PSMC4 (GFP-tagged) - Human proteasome (prosome, macropain) 26S subunit, ATPase, 4 (PSMC4), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
PSMC4 (GFP-tagged) - Human proteasome (prosome, macropain) 26S subunit, ATPase, 4 (PSMC4), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human proteasome (prosome, macropain) 26S subunit, ATPase, 4 (PSMC4), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PSMC4 (Myc-DDK tagged) - Human proteasome (prosome, macropain) 26S subunit, ATPase, 4 (PSMC4), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human proteasome (prosome, macropain) 26S subunit, ATPase, 4 (PSMC4), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PSMC4 (mGFP-tagged) - Human proteasome (prosome, macropain) 26S subunit, ATPase, 4 (PSMC4), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human proteasome (prosome, macropain) 26S subunit, ATPase, 4 (PSMC4), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PSMC4 (Myc-DDK tagged) - Human proteasome (prosome, macropain) 26S subunit, ATPase, 4 (PSMC4), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human proteasome (prosome, macropain) 26S subunit, ATPase, 4 (PSMC4), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PSMC4 (mGFP-tagged) - Human proteasome (prosome, macropain) 26S subunit, ATPase, 4 (PSMC4), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human proteasome (prosome, macropain) 26S subunit, ATPase, 4 (PSMC4), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Rabbit anti-PSMC4 Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PSMC4 |
Rabbit Polyclonal Anti-PSMC4 Antibody - N-terminal region
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PSMC4 antibody: synthetic peptide directed towards the N terminal of human PSMC4. Synthetic peptide located within the following region: MEEIGILVEKAQDEIPALSVSRPQTGLSFLGPEPEDLEDLYSRYKKLQQE |
Lenti ORF clone of Human proteasome (prosome, macropain) 26S subunit, ATPase, 4 (PSMC4), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-PSMC4 Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PSMC4 antibody: synthetic peptide directed towards the N terminal of human PSMC4. Synthetic peptide located within the following region: MEEIGILVEKAQDEIPALSVSRPQTGLSFLGPEPEDLEDLYSRYKKLQQE |
Lenti ORF clone of Human proteasome (prosome, macropain) 26S subunit, ATPase, 4 (PSMC4), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Lenti ORF clone of Human proteasome (prosome, macropain) 26S subunit, ATPase, 4 (PSMC4), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
PSMC4 (untagged)-Human proteasome (prosome, macropain) 26S subunit, ATPase, 4 (PSMC4), transcript variant 1
Vector | pCMV6-AC |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Transient overexpression lysate of proteasome (prosome, macropain) 26S subunit, ATPase, 4 (PSMC4), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
PSMC4 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
PSMC4 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of proteasome (prosome, macropain) 26S subunit, ATPase, 4 (PSMC4), transcript variant 2
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
PSMC4 MS Standard C13 and N15-labeled recombinant protein (NP_006494)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
PSMC4 (untagged)-Human proteasome (prosome, macropain) 26S subunit, ATPase, 4 (PSMC4), transcript variant 2
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Transient overexpression of PSMC4 (NM_153001) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PSMC4 (NM_006503) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PSMC4 (NM_153001) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of PSMC4 (NM_153001) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of PSMC4 (NM_006503) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of PSMC4 (NM_006503) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack