Products

cDNA Clones (25)
Proteins (17)
Antibodies (4)
Jump to Filters
View as table Download
PSME3 (NM_005789) Human Tagged ORF Clone
RC200308

USD 98.00

USD 390.00

In Stock

PSME3 (Myc-DDK-tagged)-Human proteasome (prosome, macropain) activator subunit 3 (PA28 gamma, Ki) (PSME3), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
PSME3 (NM_176863) Human Tagged ORF Clone
RC222312

USD 420.00

In Stock

PSME3 (Myc-DDK-tagged)-Human proteasome (prosome, macropain) activator subunit 3 (PA28 gamma, Ki) (PSME3), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
PSME3 (NM_005789) Human Tagged ORF Clone Lentiviral Particle
RC200308L1V

USD 1,020.00

2 Weeks

Lenti ORF particles, PSME3 (Myc-DDK tagged) - Human proteasome (prosome, macropain) activator subunit 3 (PA28 gamma; Ki) (PSME3), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
PSME3 (NM_005789) Human Tagged ORF Clone Lentiviral Particle
RC200308L2V

USD 1,020.00

5 Weeks

Lenti ORF particles, PSME3 (mGFP-tagged) - Human proteasome (prosome, macropain) activator subunit 3 (PA28 gamma; Ki) (PSME3), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
PSME3 (NM_176863) Human Tagged ORF Clone Lentiviral Particle
RC222312L1V

USD 820.00

3 Weeks

Lenti ORF particles, PSME3 (Myc-DDK tagged) - Human proteasome (prosome, macropain) activator subunit 3 (PA28 gamma; Ki) (PSME3), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
PSME3 (NM_176863) Human Tagged ORF Clone Lentiviral Particle
RC222312L2V

USD 820.00

6 Weeks

Lenti ORF particles, PSME3 (mGFP-tagged) - Human proteasome (prosome, macropain) activator subunit 3 (PA28 gamma; Ki) (PSME3), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
PSME3 (NM_001267045) Human Tagged ORF Clone
RC232329

USD 420.00

In Stock

PSME3 (Myc-DDK tagged) - Homo sapiens proteasome (prosome, macropain) activator subunit 3 (PA28 gamma, Ki) (PSME3), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PSME3 (NM_005789) Human Tagged ORF Clone
RG200308

USD 460.00

In Stock

PSME3 (GFP-tagged) - Human proteasome (prosome, macropain) activator subunit 3 (PA28 gamma; Ki) (PSME3), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PSME3 (NM_176863) Human Tagged ORF Clone
RG222312

USD 460.00

In Stock

PSME3 (GFP-tagged) - Human proteasome (prosome, macropain) activator subunit 3 (PA28 gamma; Ki) (PSME3), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PSME3 (NM_005789) Human Tagged Lenti ORF Clone
RC200308L3

USD 768.00

3 Weeks

Lenti ORF clone of Human proteasome (prosome, macropain) activator subunit 3 (PA28 gamma; Ki) (PSME3), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PSME3 (NM_005789) Human Tagged ORF Clone Lentiviral Particle
RC200308L3V

USD 1,020.00

5 Weeks

Lenti ORF particles, PSME3 (Myc-DDK tagged) - Human proteasome (prosome, macropain) activator subunit 3 (PA28 gamma; Ki) (PSME3), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PSME3 (NM_005789) Human Tagged Lenti ORF Clone
RC200308L4

USD 768.00

3 Weeks

Lenti ORF clone of Human proteasome (prosome, macropain) activator subunit 3 (PA28 gamma; Ki) (PSME3), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PSME3 (NM_005789) Human Tagged ORF Clone Lentiviral Particle
RC200308L4V

USD 1,020.00

5 Weeks

Lenti ORF particles, PSME3 (mGFP-tagged) - Human proteasome (prosome, macropain) activator subunit 3 (PA28 gamma; Ki) (PSME3), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PSME3 (NM_176863) Human Tagged ORF Clone
RC222312L3

USD 620.00

3 Weeks

Lenti ORF clone of Human proteasome (prosome, macropain) activator subunit 3 (PA28 gamma; Ki) (PSME3), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PSME3 (NM_176863) Human Tagged ORF Clone Lentiviral Particle
RC222312L3V

USD 820.00

5 Weeks

Lenti ORF particles, PSME3 (Myc-DDK tagged) - Human proteasome (prosome, macropain) activator subunit 3 (PA28 gamma; Ki) (PSME3), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PSME3 (NM_176863) Human Tagged ORF Clone
RC222312L4

USD 620.00

3 Weeks

Lenti ORF clone of Human proteasome (prosome, macropain) activator subunit 3 (PA28 gamma; Ki) (PSME3), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PSME3 (NM_176863) Human Tagged ORF Clone Lentiviral Particle
RC222312L4V

USD 820.00

7 Weeks

Lenti ORF particles, PSME3 (mGFP-tagged) - Human proteasome (prosome, macropain) activator subunit 3 (PA28 gamma; Ki) (PSME3), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PSME3 (NM_001267045) Human Tagged ORF Clone
RG232329

USD 460.00

3 Weeks

PSME3 (GFP-tagged) - Homo sapiens proteasome (prosome, macropain) activator subunit 3 (PA28 gamma; Ki) (PSME3), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PSME3 (NM_176863) Human Tagged ORF Clone
RC222312L1

USD 768.00

In Stock

Lenti ORF clone of Human proteasome (prosome, macropain) activator subunit 3 (PA28 gamma; Ki) (PSME3), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
PSME3 (NM_005789) Human Tagged Lenti ORF Clone
RC200308L1

USD 768.00

In Stock

Lenti ORF clone of Human proteasome (prosome, macropain) activator subunit 3 (PA28 gamma; Ki) (PSME3), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
PSME3 (NM_005789) Human Untagged Clone
SC321554

USD 310.00

In Stock

PSME3 (untagged)-Human proteasome (prosome, macropain) activator subunit 3 (PA28 gamma, Ki) (PSME3), transcript variant 1

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
PSME3 Rabbit Polyclonal Antibody
TA326811

USD 275.00

3 Weeks

PSME3 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PSME3
PSME3 (NM_005789) Human Tagged Lenti ORF Clone
RC200308L2

USD 768.00

3 Weeks

Lenti ORF clone of Human proteasome (prosome, macropain) activator subunit 3 (PA28 gamma; Ki) (PSME3), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
PSME3 (NM_176863) Human Tagged ORF Clone
RC222312L2

USD 620.00

3 Weeks

Lenti ORF clone of Human proteasome (prosome, macropain) activator subunit 3 (PA28 gamma; Ki) (PSME3), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
PSME3 Rabbit Polyclonal Antibody
TA308562

USD 415.00

5 Days

Rabbit Polyclonal antibody to PSME3 (proteasome (prosome, macropain) activator subunit 3 (PA28 gamma; Ki))

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 254 of PSME3
PSME3 (NM_005789) Human Over-expression Lysate
LC417076

USD 121.00

In Stock

PSME3 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PSME3 (NM_176863) Human Untagged Clone
SC310584

USD 660.00

In Stock

PSME3 (untagged)-Human proteasome (prosome, macropain) activator subunit 3 (PA28 gamma, Ki) (PSME3), transcript variant 2

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
SC310584 is the updated version of SC107168.
PSME3 Rabbit Polyclonal Antibody
TA339290

USD 375.00

5 Days

Rabbit Polyclonal Anti-PSME3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PSME3 antibody is: synthetic peptide directed towards the N-terminal region of Human PSME3. Synthetic peptide located within the following region: PILNIHDLTQIHSDMNLPVPDPILLTNSHDGLDGPTYKKRRLDECEEAFQ
PSME3 Rabbit Polyclonal Antibody
TA339291

USD 310.00

5 Days

Rabbit Polyclonal Anti-PSME3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PSME3 antibody: synthetic peptide directed towards the C terminal of human PSME3. Synthetic peptide located within the following region: TVTEIDEKEYISLRLIISELRNQYVTLHDMILKNIEKIKRPRSSNAETLY
PSME3 (NM_176863) Human Over-expression Lysate
LY406114

USD 396.00

5 Days

Transient overexpression lysate of proteasome (prosome, macropain) activator subunit 3 (PA28 gamma; Ki) (PSME3), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PSME3 (NM_005789) Human Over-expression Lysate
LY417076

USD 396.00

5 Days

Transient overexpression lysate of proteasome (prosome, macropain) activator subunit 3 (PA28 gamma; Ki) (PSME3), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PSME3 (1-254, His-tag) Human Protein
AR50127PU-N

USD 845.00

2 Weeks

PSME3 (1-254, His-tag) human recombinant protein, 0.25 mg

Tag His-tag
Expression Host E. coli
PSME3 (1-254, His-tag) Human Protein
AR50127PU-S

USD 330.00

2 Weeks

PSME3 (1-254, His-tag) human recombinant protein, 50 µg

Tag His-tag
Expression Host E. coli
PSME3 (NM_176863) Human Over-expression Lysate
LC406114

USD 121.00

2 Weeks

PSME3 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PSME3 (NM_005789) Human Mass Spec Standard
PH300308

USD 2,055.00

3 Weeks

PSME3 MS Standard C13 and N15-labeled recombinant protein (NP_005780)

Tag C-Myc/DDK
Expression Host HEK293
PSME3 (NM_001267045) Human Untagged Clone
SC330746

USD 310.00

3 Weeks

PSME3 (untagged) - Homo sapiens proteasome (prosome, macropain) activator subunit 3 (PA28 gamma, Ki) (PSME3), transcript variant 3

Vector pCMV6 series
Tag Tag Free
PSME3 (NM_005789) ICC Control Block
TB400308

USD 1,040.00

4 Weeks

Transient overexpression of PSME3 (NM_005789) in HEK293T cells paraffin embedded controls for ICC/IHC staining

PSME3 (NM_176863) ICC Control Block
TB422312

USD 1,070.00

4 Weeks

Transient overexpression of PSME3 (NM_176863) in HEK293T cells paraffin embedded controls for ICC/IHC staining

PSME3 (NM_001267045) ICC Control Block
TB432329

USD 1,070.00

4 Weeks

Transient overexpression of PSME3 (NM_001267045) in HEK293T cells paraffin embedded controls for ICC/IHC staining

PSME3 Cytosection
TS400308

USD 225.00

4 Weeks

Transient overexpression of PSME3 (NM_005789) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

PSME3 Cytosection
TS400308P5

USD 889.00

4 Weeks

Transient overexpression of PSME3 (NM_005789) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

PSME3 Cytosection
TS422312

USD 225.00

4 Weeks

Transient overexpression of PSME3 (NM_176863) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

PSME3 Cytosection
TS422312P5

USD 889.00

4 Weeks

Transient overexpression of PSME3 (NM_176863) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

PSME3 Cytosection
TS432329

USD 225.00

4 Weeks

Transient overexpression of PSME3 (NM_001267045) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

PSME3 Cytosection
TS432329P5

USD 889.00

4 Weeks

Transient overexpression of PSME3 (NM_001267045) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack