AK3 (Myc-DDK-tagged)-Human adenylate kinase 3 (AK3), nuclear gene encoding mitochondrial protein, transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
AK3 (Myc-DDK-tagged)-Human adenylate kinase 3 (AK3), nuclear gene encoding mitochondrial protein, transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human adenylate kinase 3 (AK3), nuclear gene encoding mitochondrial protein
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Lenti ORF particles, AK3 (Myc-DDK tagged) - Human adenylate kinase 3 (AK3), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, AK3 (mGFP-tagged) - Human adenylate kinase 3 (AK3), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
AK3 (GFP-tagged) - Human adenylate kinase 3 (AK3), nuclear gene encoding mitochondrial protein, transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human adenylate kinase 3 (AK3), nuclear gene encoding mitochondrial protein, transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, AK3 (Myc-DDK tagged) - Human adenylate kinase 3 (AK3), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human adenylate kinase 3 (AK3), nuclear gene encoding mitochondrial protein, transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, AK3 (mGFP-tagged) - Human adenylate kinase 3 (AK3), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
AK3 (Myc-DDK tagged) - Homo sapiens adenylate kinase 3 (AK3), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
AK3 (Myc-DDK tagged) - Homo sapiens adenylate kinase 3 (AK3), transcript variant 5
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
AK3 (Myc-DDK tagged) - Homo sapiens adenylate kinase 3 (AK3), transcript variant 6
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
AK3 (Myc-DDK tagged) - Homo sapiens adenylate kinase 3 (AK3), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
AK3 (GFP-tagged) - Homo sapiens adenylate kinase 3 (AK3), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
AK3 (GFP-tagged) - Homo sapiens adenylate kinase 3 (AK3), transcript variant 5
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
AK3 (GFP-tagged) - Homo sapiens adenylate kinase 3 (AK3), transcript variant 6
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
AK3 (GFP-tagged) - Homo sapiens adenylate kinase 3 (AK3), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human adenylate kinase 3 (AK3), nuclear gene encoding mitochondrial protein, transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-AK3 Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-AK3 antibody: synthetic peptide directed towards the N terminal of human AK3. Synthetic peptide located within the following region: MGASARLLRAVIMGAPGSGKGTVSSRITTHFELKHLSSGDLLRDNMLRGT |
Lenti ORF clone of Human adenylate kinase 3 (AK3), nuclear gene encoding mitochondrial protein, transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
AK3 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of adenylate kinase 3 (AK3), nuclear gene encoding mitochondrial protein
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
AK3 (untagged)-Human adenylate kinase 3 (AK3), nuclear gene encoding mitochondrial protein, transcript variant 1
Vector | pCMV6-AC |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Adenylate kinase 3 / AK3 (1-223) human recombinant protein, 0.5 mg
Expression Host | E. coli |
Adenylate kinase 3 / AK3 (1-223) human recombinant protein, 0.1 mg
Expression Host | E. coli |
Carrier-free (BSA/glycerol-free) AK3 mouse monoclonal antibody, clone OTI5A1 (formerly 5A1)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) AK3 mouse monoclonal antibody, clone OTI6D6 (formerly 6D6)
Applications | WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) AK3 mouse monoclonal antibody, clone OTI3G1 (formerly 3G1)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) AK3 mouse monoclonal antibody, clone OTI6B7 (formerly 6B7)
Applications | IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) AK3 mouse monoclonal antibody, clone OTI4A2 (formerly 4A2)
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) AK3 mouse monoclonal antibody, clone OTI6G4 (formerly 6G4)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) AK3 mouse monoclonal antibody, clone OTI4C4 (formerly 4C4)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
AK3 MS Standard C13 and N15-labeled recombinant protein (NP_057366)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
AK3 (untagged)-Human adenylate kinase 3 (AK3), nuclear gene encoding mitochondrial protein, transcript variant 1
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
AK3 (untagged) - Homo sapiens adenylate kinase 3 (AK3), transcript variant 2
Vector | pCMV6 series |
Tag | Tag Free |
AK3 (untagged) - Homo sapiens adenylate kinase 3 (AK3), transcript variant 3
Vector | pCMV6 series |
Tag | Tag Free |
AK3 (untagged) - Homo sapiens adenylate kinase 3 (AK3), transcript variant 5
Vector | pCMV6 series |
Tag | Tag Free |
AK3 (untagged) - Homo sapiens adenylate kinase 3 (AK3), transcript variant 6
Vector | pCMV6 series |
Tag | Tag Free |
AK3 mouse monoclonal antibody, clone OTI5A1 (formerly 5A1)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
AK3 mouse monoclonal antibody, clone OTI5A1 (formerly 5A1), Biotinylated
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
AK3 mouse monoclonal antibody, clone OTI5A1 (formerly 5A1), HRP conjugated
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
AK3 mouse monoclonal antibody, clone OTI5A1 (formerly 5A1)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
AK3 mouse monoclonal antibody, clone OTI6D6 (formerly 6D6)
Applications | WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
AK3 mouse monoclonal antibody, clone OTI6D6 (formerly 6D6), Biotinylated
Applications | WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Biotin |
AK3 mouse monoclonal antibody, clone OTI6D6 (formerly 6D6), HRP conjugated
Applications | WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | HRP |
AK3 mouse monoclonal antibody, clone OTI6D6 (formerly 6D6)
Applications | WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
AK3 mouse monoclonal antibody, clone OTI3G1 (formerly 3G1)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
AK3 mouse monoclonal antibody, clone OTI3G1 (formerly 3G1), Biotinylated
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
AK3 mouse monoclonal antibody, clone OTI3G1 (formerly 3G1), HRP conjugated
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
AK3 mouse monoclonal antibody, clone OTI3G1 (formerly 3G1)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |