Products

cDNA Clones (24)
Proteins (20)
Antibodies (6)
Jump to Filters
View as table Download
ENO3 (NM_053013) Human Tagged ORF Clone
RC205684

USD 420.00

In Stock

ENO3 (Myc-DDK-tagged)-Human enolase 3 (beta, muscle) (ENO3), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
ENO3 (NM_001976) Human Tagged ORF Clone
RC219257

USD 420.00

In Stock

ENO3 (Myc-DDK-tagged)-Human enolase 3 (beta, muscle) (ENO3), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
ENO3 (NM_001193503) Human Tagged ORF Clone
RC231202

USD 420.00

In Stock

ENO3 (Myc-DDK-tagged)-Human enolase 3 (beta, muscle) (ENO3), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
ENO3 (NM_053013) Human Tagged ORF Clone Lentiviral Particle
RC205684L1V

USD 820.00

3 Weeks

Lenti ORF particles, ENO3 (Myc-DDK tagged) - Human enolase 3 (beta, muscle) (ENO3), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
ENO3 (NM_053013) Human Tagged ORF Clone Lentiviral Particle
RC205684L2V

USD 820.00

6 Weeks

Lenti ORF particles, ENO3 (mGFP-tagged) - Human enolase 3 (beta, muscle) (ENO3), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
ENO3 (NM_001976) Human Tagged ORF Clone
RG219257

USD 460.00

In Stock

ENO3 (GFP-tagged) - Human enolase 3 (beta, muscle) (ENO3), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
ENO3 (NM_053013) Human Tagged ORF Clone
RC205684L3

USD 620.00

3 Weeks

Lenti ORF clone of Human enolase 3 (beta, muscle) (ENO3), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ENO3 (NM_053013) Human Tagged ORF Clone Lentiviral Particle
RC205684L3V

USD 820.00

5 Weeks

Lenti ORF particles, ENO3 (Myc-DDK tagged) - Human enolase 3 (beta, muscle) (ENO3), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ENO3 (NM_053013) Human Tagged ORF Clone
RC205684L4

USD 620.00

3 Weeks

Lenti ORF clone of Human enolase 3 (beta, muscle) (ENO3), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ENO3 (NM_053013) Human Tagged ORF Clone Lentiviral Particle
RC205684L4V

USD 820.00

7 Weeks

Lenti ORF particles, ENO3 (mGFP-tagged) - Human enolase 3 (beta, muscle) (ENO3), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ENO3 (NM_001976) Human Tagged ORF Clone
RC219257L3

USD 620.00

3 Weeks

Lenti ORF clone of Human enolase 3 (beta, muscle) (ENO3), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ENO3 (NM_001976) Human Tagged ORF Clone Lentiviral Particle
RC219257L3V

USD 820.00

6 Weeks

Lenti ORF particles, ENO3 (Myc-DDK tagged) - Human enolase 3 (beta, muscle) (ENO3), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ENO3 (NM_001976) Human Tagged ORF Clone
RC219257L4

USD 620.00

3 Weeks

Lenti ORF clone of Human enolase 3 (beta, muscle) (ENO3), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ENO3 (NM_001976) Human Tagged ORF Clone Lentiviral Particle
RC219257L4V

USD 820.00

6 Weeks

Lenti ORF particles, ENO3 (mGFP-tagged) - Human enolase 3 (beta, muscle) (ENO3), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ENO3 (NM_001193503) Human Tagged ORF Clone
RC231202L3

USD 620.00

3 Weeks

Lenti ORF clone of Human enolase 3 (beta, muscle) (ENO3), transcript variant 3, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ENO3 (NM_001193503) Human Tagged ORF Clone Lentiviral Particle
RC231202L3V

USD 820.00

6 Weeks

Lenti ORF particles, ENO3 (Myc-DDK tagged) - Human enolase 3 (beta, muscle) (ENO3), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ENO3 (NM_001193503) Human Tagged ORF Clone
RC231202L4

USD 620.00

3 Weeks

Lenti ORF clone of Human enolase 3 (beta, muscle) (ENO3), transcript variant 3, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ENO3 (NM_001193503) Human Tagged ORF Clone Lentiviral Particle
RC231202L4V

USD 820.00

6 Weeks

Lenti ORF particles, ENO3 (mGFP-tagged) - Human enolase 3 (beta, muscle) (ENO3), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ENO3 (NM_053013) Human Tagged ORF Clone
RG205684

USD 460.00

3 Weeks

ENO3 (GFP-tagged) - Human enolase 3 (beta, muscle) (ENO3), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
ENO3 (NM_001193503) Human Tagged ORF Clone
RG231202

USD 460.00

3 Weeks

ENO3 (GFP-tagged) - Human enolase 3 (beta, muscle) (ENO3), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
ENO3 (NM_001976) Human Untagged Clone
SC118914

USD 310.00

In Stock

ENO3 (untagged)-Human enolase 3 (beta, muscle) (ENO3), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
ENO3 Rabbit Polyclonal Antibody
TA346568

USD 475.00

5 Days

Rabbit Polyclonal Anti-ENO3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ENO3 antibody: synthetic peptide directed towards the N terminal of human ENO3. Synthetic peptide located within the following region: EVDLHTAKGRFRAAVPSGASTGIYEALELRDGDKGRYLGKGVLKAVENIN
ENO3 Rabbit Polyclonal Antibody
TA346567

USD 410.00

5 Days

Rabbit Polyclonal Anti-ENO3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ENO3 antibody: synthetic peptide directed towards the N terminal of human ENO3. Synthetic peptide located within the following region: MAMQKIFAREILDSRGNPTVEVDLHTAKGRFRAAVPSGASTGIYEALELR
Enolase beta (1-434, His-tag) Human Protein
AR50087PU-N

USD 1,105.00

2 Weeks

Enolase beta (1-434, His-tag) human recombinant protein, 0.25 mg

Tag His-tag
Expression Host E. coli
Enolase beta (1-434, His-tag) Human Protein
AR50087PU-S

USD 415.00

2 Weeks

Enolase beta (1-434, His-tag) human recombinant protein, 50 µg

Tag His-tag
Expression Host E. coli
ENO3 (NM_053013) Human Tagged ORF Clone
RC205684L1

USD 620.00

In Stock

Lenti ORF clone of Human enolase 3 (beta, muscle) (ENO3), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
ENO3 Mouse Monoclonal Antibody [Clone ID: 5D1]
AM31050PU-N

USD 480.00

2 Weeks

ENO3 mouse monoclonal antibody, clone 5D1, Purified

Applications ELISA, IF, IHC, WB
Reactivities Human
ENO3 Rabbit Polyclonal Antibody
TA347846

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-b-Enolase(ENO-3) Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-b-Enolase(ENO-3) Antibody: Peptide sequence around aa.49~53(L-R-D-G-D) derived from Human b-Enolase(ENO-3).
ENO3 (NM_053013) Human Tagged ORF Clone
RC205684L2

USD 620.00

3 Weeks

Lenti ORF clone of Human enolase 3 (beta, muscle) (ENO3), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
ENO3 (NM_053013) Human Untagged Clone
SC319614

USD 310.00

In Stock

ENO3 (untagged)-Human enolase 3 (beta, muscle) (ENO3), transcript variant 2

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
ENO3 (NM_001976) Human Over-expression Lysate
LC419609

USD 121.00

In Stock

ENO3 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
ENO3 (NM_001193503) Human Over-expression Lysate
LC434201

USD 121.00

In Stock

ENO3 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
ENO3 (NM_001976) Human Over-expression Lysate
LY419609

USD 396.00

In Stock

Transient overexpression lysate of enolase 3 (beta, muscle) (ENO3), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
ENO3 (NM_001193503) Human Over-expression Lysate
LY434201

USD 396.00

In Stock

Transient overexpression lysate of enolase 3 (beta, muscle) (ENO3), transcript variant 3

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
ENO3 Rabbit Polyclonal Antibody
TA308243

USD 415.00

5 Days

Rabbit Polyclonal antibody to ENO3 (enolase 3 (beta, muscle))

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 196 and 434 of ENO3 (Uniprot ID#P13929)
ENO3 Rabbit Polyclonal Antibody
TA324090

USD 345.00

4 Weeks

Anti-ENO3 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide sequence around aa.49~53(L-R-D-G-D) derived from Human β-Enolase(ENO-3).
ENO3 (NM_053013) Human Over-expression Lysate
LC409322

USD 121.00

2 Weeks

ENO3 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
ENO3 (NM_053013) Human Over-expression Lysate
LY409322

USD 396.00

5 Days

Transient overexpression lysate of enolase 3 (beta, muscle) (ENO3), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
ENO3 (NM_053013) Human Mass Spec Standard
PH305684

USD 2,055.00

3 Weeks

ENO3 MS Standard C13 and N15-labeled recombinant protein (NP_443739)

Tag C-Myc/DDK
Expression Host HEK293
ENO3 (NM_001976) Human Mass Spec Standard
PH319257

USD 2,055.00

3 Weeks

ENO3 MS Standard C13 and N15-labeled recombinant protein (NP_001967)

Tag C-Myc/DDK
Expression Host HEK293
ENO3 ICC Control Block
TB405684

USD 1,070.00

4 Weeks

Transient overexpression of ENO3 (NM_053013) in HEK293T cells paraffin embedded controls for ICC/IHC staining

ENO3 ICC Control Block
TB419257

USD 1,070.00

4 Weeks

Transient overexpression of ENO3 (NM_001976) in HEK293T cells paraffin embedded controls for ICC/IHC staining

ENO3 ICC Control Block
TB431202

USD 1,070.00

4 Weeks

Transient overexpression of ENO3 (NM_001193503) in HEK293T cells paraffin embedded controls for ICC/IHC staining

ENO3 Cytosection
TS405684

USD 225.00

4 Weeks

Transient overexpression of ENO3 (NM_053013) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

ENO3 Cytosection
TS405684P5

USD 889.00

4 Weeks

Transient overexpression of ENO3 (NM_053013) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

ENO3 Cytosection
TS419257

USD 225.00

4 Weeks

Transient overexpression of ENO3 (NM_001976) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

ENO3 Cytosection
TS419257P5

USD 889.00

4 Weeks

Transient overexpression of ENO3 (NM_001976) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

ENO3 Cytosection
TS431202

USD 225.00

4 Weeks

Transient overexpression of ENO3 (NM_001193503) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

ENO3 Cytosection
TS431202P5

USD 889.00

4 Weeks

Transient overexpression of ENO3 (NM_001193503) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack