Germany
Japan
United Kingdom
China
CDC5L (Myc-DDK-tagged)-Human CDC5 cell division cycle 5-like (S. pombe) (CDC5L)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Lenti ORF particles, CDC5L (Myc-DDK tagged) - Human CDC5 cell division cycle 5-like (S. pombe) (CDC5L), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, CDC5L (mGFP-tagged) - Human CDC5 cell division cycle 5-like (S. pombe) (CDC5L), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
CDC5L (GFP-tagged) - Human CDC5 cell division cycle 5-like (S. pombe) (CDC5L)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Recombinant protein of human CDC5 cell division cycle 5-like (S. pombe) (CDC5L)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Lenti ORF clone of Human CDC5 cell division cycle 5-like (S. pombe) (CDC5L), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, CDC5L (Myc-DDK tagged) - Human CDC5 cell division cycle 5-like (S. pombe) (CDC5L), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human CDC5 cell division cycle 5-like (S. pombe) (CDC5L), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, CDC5L (mGFP-tagged) - Human CDC5 cell division cycle 5-like (S. pombe) (CDC5L), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human CDC5 cell division cycle 5-like (S. pombe) (CDC5L), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human CDC5 cell division cycle 5-like (S. pombe) (CDC5L), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit Polyclonal Anti-CDC5L Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CDC5L antibody: synthetic peptide directed towards the middle region of human CDC5L. Synthetic peptide located within the following region: LHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATADEQGEFEEEEGEDE |
CDC5L (untagged)-Human CDC5 cell division cycle 5-like (S. pombe) (CDC5L)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit anti-CDC5L Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CDC5L |
CDC5L (untagged)-Human CDC5 cell division cycle 5-like (S. pombe) (CDC5L)
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
CDC5L HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of CDC5 cell division cycle 5-like (S. pombe) (CDC5L)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
CDC5L MS Standard C13 and N15-labeled recombinant protein (NP_001244)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Rabbit Polyclonal Anti-CDC5L Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human CDC5L |
Transient overexpression of CDC5L (NM_001253) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CDC5L (NM_001253) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CDC5L (NM_001253) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- CDC5L
Pathways
- Spliceosome