Germany
Japan
United Kingdom
China
CDC5L (Myc-DDK-tagged)-Human CDC5 cell division cycle 5-like (S. pombe) (CDC5L)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Lenti ORF particles, CDC5L (Myc-DDK tagged) - Human CDC5 cell division cycle 5-like (S. pombe) (CDC5L), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, CDC5L (mGFP-tagged) - Human CDC5 cell division cycle 5-like (S. pombe) (CDC5L), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Cdc5l (Myc-DDK-tagged) - Mouse cell division cycle 5-like (S. pombe) (cDNA clone MGC:6754 IMAGE:3593535)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Cdc5l (GFP-tagged) - Mouse cell division cycle 5-like (S. pombe) (cDNA clone MGC:6754 IMAGE:3593535)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
CDC5L (GFP-tagged) - Human CDC5 cell division cycle 5-like (S. pombe) (CDC5L)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Recombinant protein of human CDC5 cell division cycle 5-like (S. pombe) (CDC5L)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Cdc5l (GFP-tagged) - Mouse cell division cycle 5-like (S. pombe) (Cdc5l)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
CDC5L - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN401702 is the updated version of KN201702.
Cdc5l - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN502985 is the updated version of KN302985.
Lenti ORF clone of Cdc5l (Myc-DDK-tagged) - Mouse cell division cycle 5-like (S. pombe) (cDNA clone MGC:6754 IMAGE:3593535)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Cdc5l (Myc-DDK-tagged) - Mouse cell division cycle 5-like (S. pombe) (cDNA clone MGC:6754 IMAGE:3593535), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Cdc5l (mGFP-tagged) - Mouse cell division cycle 5-like (S. pombe) (cDNA clone MGC:6754 IMAGE:3593535)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Cdc5l (GFP-tagged) - Mouse cell division cycle 5-like (S. pombe) (cDNA clone MGC:6754 IMAGE:3593535), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Cdc5l (Myc-DDK-tagged) - Mouse cell division cycle 5-like (S. pombe) (Cdc5l)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Cdc5l (Myc-DDK-tagged) - Mouse cell division cycle 5-like (S. pombe) (Cdc5l)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Cdc5l (Myc-DDK-tagged) - Mouse cell division cycle 5-like (S. pombe) (Cdc5l), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Cdc5l (mGFP-tagged) - Mouse cell division cycle 5-like (S. pombe) (Cdc5l)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Cdc5l (GFP-tagged) - Mouse cell division cycle 5-like (S. pombe) (Cdc5l), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human CDC5 cell division cycle 5-like (S. pombe) (CDC5L), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, CDC5L (Myc-DDK tagged) - Human CDC5 cell division cycle 5-like (S. pombe) (CDC5L), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human CDC5 cell division cycle 5-like (S. pombe) (CDC5L), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, CDC5L (mGFP-tagged) - Human CDC5 cell division cycle 5-like (S. pombe) (CDC5L), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Cdc5l (Myc-DDK-tagged ORF) - Rat CDC5 cell division cycle 5-like (S. pombe) (Cdc5l), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Cdc5l (Myc-DDK-tagged ORF) - Rat CDC5 cell division cycle 5-like (S. pombe) (Cdc5l), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Cdc5l (Myc-DDK-tagged ORF) - Rat CDC5 cell division cycle 5-like (S. pombe) (Cdc5l), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Cdc5l (mGFP-tagged ORF) - Rat CDC5 cell division cycle 5-like (S. pombe) (Cdc5l), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Cdc5l (GFP-tagged ORF) - Rat CDC5 cell division cycle 5-like (S. pombe) (Cdc5l), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human CDC5 cell division cycle 5-like (S. pombe) (CDC5L), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human CDC5 cell division cycle 5-like (S. pombe) (CDC5L), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit Polyclonal Anti-CDC5L Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CDC5L antibody: synthetic peptide directed towards the middle region of human CDC5L. Synthetic peptide located within the following region: LHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATADEQGEFEEEEGEDE |
CDC5L (untagged)-Human CDC5 cell division cycle 5-like (S. pombe) (CDC5L)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit anti-CDC5L Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CDC5L |
CDC5L (untagged)-Human CDC5 cell division cycle 5-like (S. pombe) (CDC5L)
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
CDC5L - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
| E. coli Selection | Ampicillin |
| Mammalian Cell Selection | Puromycin |
qSTAR qPCR primer pairs against Homo sapiens gene CDC5L
| Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
Cdc5l (untagged) - Mouse cell division cycle 5-like (S. pombe) (Cdc5l), (10ug)
| Vector | PCMV6-Kan/Neo |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
CDC5L CRISPRa kit - CRISPR gene activation of human cell division cycle 5 like
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene CDC5L
| Application | Plasmid of exact quantity for transcript copy number calculation |
CDC5L HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of CDC5 cell division cycle 5-like (S. pombe) (CDC5L)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
qPCR primer pairs and template standards against Mus musculus gene Cdc5l
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Mus musculus gene Cdc5l
CDC5L MS Standard C13 and N15-labeled recombinant protein (NP_001244)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Cdc5l (untagged ORF) - Rat CDC5 cell division cycle 5-like (S. pombe) (Cdc5l), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
3`UTR clone of CDC5 cell division cycle 5-like (S. pombe) (CDC5L) for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
CDC5L (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Cdc5l (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Cdc5l (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Rabbit Polyclonal Anti-CDC5L Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human CDC5L |
Active filters
Target Symbol
- CDC5L